Welcome!

gget is a free, open-source command-line tool and Python package that enables efficient querying of genomic databases.

gget consists of a collection of separate but interoperable modules, each designed to facilitate one type of database querying in a single line of code.

NOTE: The databases queried by gget are continuously being updated which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary. If you encounter a problem, please upgrade to the latest gget version using pip install --upgrade gget. If the problem persists, please report the issue.

 
 Request a new feature 
 

gget info and gget seq are currently unable to fetch information for WormBase and FlyBase IDs (all other IDs are functioning normally). This issue arose due to a bug in Ensembl release 112. We appreciate Ensembl's efforts in addressing this issue and expect a fix soon. Thank you for your patience.

gget modules

These are the gget core modules. Click on any module to access detailed documentation.

If you use gget in a publication, please cite*:

Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

Read the article here: https://doi.org/10.1093/bioinformatics/btac836

✨ What's new

Version ≥ 0.29.0 (Sep 25, 2024):

• New modules:
  • gget cbio
  • gget opentargets
  • gget bgee
• gget enrichr now also supports species other than human and mouse (fly, yeast, worm, and fish) via modEnrichR
• gget mutate:
  gget mutate will now merge identical sequences in the final file by default. Mutation creation was vectorized to decrease runtime. Improved flanking sequence check for non-substitution mutations to make sure no wildtype kmer is retained in the mutation-containing sequence. Addition of several new arguments to customize sequence generation and output.
• gget cosmic:
  Added support for targeted as well as gene screens. The CSV file created for gget mutate now also contains protein mutation info.
• gget ref:
  Added out file option.
• gget info and gget seq:
  Switched to Ensembl POST API to increase speed (nothing changes in front end).
• Other "behind the scenes" changes:
  • Unit tests reorganized to increase speed and decrease code
  • Requirements updated to allow newer mysql-connector versions
  • Support Numpy>= 2.0

Version ≥ 0.28.6 (Jun 2, 2024):

• New module: gget mutate
• gget cosmic: You can now download entire COSMIC databases using the argument download_cosmic argument
• gget ref: Can now fetch the GRCh37 genome assembly using species='human_grch37'
• gget search: Adjust access of human data to the structure of Ensembl release 112 (fixes issue 129)

Version ≥ 0.28.5 (May 29, 2024):

• Yanked due to logging bug in gget.setup("alphafold") + inversion mutations in gget mutate only reverse the string instead of also computing the complementary strand

Version ≥ 0.28.4 (January 31, 2024):

• gget setup: Fix bug with filepath when running gget.setup("elm") on Windows OS.

Version ≥ 0.28.3 (January 22, 2024):

• gget search and gget ref now also support fungi 🍄, protists 🌝, and invertebrate metazoa 🐝 🐜 🐌 🐙 (in addition to vertebrates and plants)
• New module: gget cosmic
• gget enrichr: Fix duplicate scatter dots in plot when pathway names are duplicated
• gget elm:
  • Changed ortho results column name 'Ortholog_UniProt_ID' to 'Ortholog_UniProt_Acc' to correctly reflect the column contents, which are UniProt Accessions. 'UniProt ID' was changed to 'UniProt Acc' in the documentation for all gget modules.
  • Changed ortho results column name 'motif_in_query' to 'motif_inside_subject_query_overlap'.
  • Added interaction domain information to results (new columns: "InteractionDomainId", "InteractionDomainDescription", "InteractionDomainName").
  • The regex string for regular expression matches was encapsulated as follows: "(?=(regex))" (instead of directly passing the regex string "regex") to enable capturing all occurrences of a motif when the motif length is variable and there are repeats in the sequence (https://regex101.com/r/HUWLlZ/1).
• gget setup: Use the out argument to specify a directory the ELM database will be downloaded into. Completes this feature request.
• gget diamond: The DIAMOND command is now run with --ignore-warnings flag, allowing niche sequences such as amino acid sequences that only contain nucleotide characters and repeated sequences. This is also true for DIAMOND alignments performed within gget elm.
• gget ref and gget search back-end change: the current Ensembl release is fetched from the new release file on the Ensembl FTP site to avoid errors during uploads of new releases.
• gget search:
  • FTP link results (--ftp) are saved in txt file format instead of json.
  • Fix URL links to Ensembl gene summary for species with a subspecies name and invertebrates.
• gget ref:
  • Back-end changes to increase speed
  • New argument: list_iv_species to list all available invertebrate species (can be combined with the release argument to fetch all species available from a specific Ensembl release)

Version ≥ 0.28.2 (November 15, 2023):

• gget info: Return a logging error message when the NCBI server fails for a reason other than a fetch fail (this is an error on the server side rather than an error with gget)
• Replace deprecated 'text' argument to find()-type methods whenever used with dependency BeautifulSoup
• gget elm: Remove false positive and true negative instances from returned results
• gget elm: Add expand argument

Version ≥ 0.28.0 (November 5, 2023):

• Updated documentation of gget muscle to add a tutorial on how to visualize sequences with varying sequence name lengths + slight change to returned visualization so it's a bit more robust to varying sequence names
• gget muscle now also allows a list of sequences as input (as an alternative to providing the path to a FASTA file)
• Allow missing gene filter for gget cellxgene (fixes bug)
• gget seq: Allow missing gene names (fixes https://github.com/pachterlab/gget/issues/107)
• gget enrichr: Use new arguments kegg_out and kegg_rank to create an image of the KEGG pathway with the genes from the enrichment analysis highlighted (thanks to this PR by Noriaki Sato)
• New modules: gget elm and gget diamond

Version ≥ 0.27.9 (August 7, 2023):

• gget enrichr: Use new argument background_list to provide a list of background genes
• gget search now also searches Ensembl synonyms (in addition to gene descriptions and names) to return more comprehensive search results (thanks to Samuel Klein for the suggestion)

Version ≥ 0.27.8 (July 12, 2023):

• gget search: Specify the Ensembl release from which information is fetched with new argument -r --release
• Fixed bug in gget pdb (this bug was introduced in version 0.27.5)

Version ≥ 0.27.7 (May 15, 2023):

• Moved dependencies for modules gget gpt and gget cellxgene from automatically installed requirements to gget setup.
• Updated gget alphafold dependencies for compatibility with Python >= 3.10.
• Added census_version argument to gget cellxgene.

Version ≥ 0.27.6 (May 1, 2023) (YANKED due to problems with dependencies -> replaced with version 0.27.7):

• Thanks to PR by Tomás Di Domenico: gget search can now also query plant 🌱 Ensembl IDs.
• New module: gget cellxgene

Version ≥ 0.27.5 (April 6, 2023):

• Updated gget search to function correctly with new Pandas version 2.0.0 (released on April 3rd, 2023) as well as older versions of Pandas
• Updated gget info with new flags uniprot and ncbi which allow turning off results from these databases independently to save runtime (note: flag ensembl_only was deprecated)
• All gget modules now feature a -q / --quiet (Python: verbose=False) flag to turn off progress information

Version ≥ 0.27.4 (March 19, 2023):

• New module: gget gpt

Version ≥ 0.27.3 (March 11, 2023):

• gget info excludes PDB IDs by default to increase speed (PDB results can be included using flag --pdb / pdb=True).

Version ≥ 0.27.2 (January 1, 2023):

• Updated gget alphafold to DeepMind's AlphaFold v2.3.0 (including new arguments multimer_for_monomer and multimer_recycles)

Version ≥ 0.27.0 (December 10, 2022):

• Updated gget alphafold to match recent changes by DeepMind
• Updated version number to match gget's creator's age following a long-standing Pachter lab tradition

Version ≥ 0.3.13 (November 11, 2022):

• Reduced runtime for gget enrichr and gget archs4 when used with Ensembl IDs

Version ≥ 0.3.12 (November 10, 2022):

• gget info now also returns subcellular localisation data from UniProt
• New gget info flag ensembl_only returns only Ensembl results
• Reduced runtime for gget info and gget seq

Version ≥ 0.3.11 (September 7, 2022):

• New module: gget pdb

Version ≥ 0.3.10 (September 2, 2022):

• gget alphafold now also returns pLDDT values for generating plots from output without rerunning the program (also see the gget alphafold FAQ)

Version ≥ 0.3.9 (August 25, 2022):

• Updated openmm installation instructions for gget alphafold

Version ≥ 0.3.8 (August 12, 2022):

• Fixed mysql-connector-python version requirements

Version ≥ 0.3.7 (August 9, 2022):

• NOTE: The Ensembl FTP site changed its structure on August 8, 2022. Please upgrade to gget version ≥ 0.3.7 if you use gget ref

Version ≥ 0.3.5 (August 6, 2022):

• New module: gget alphafold

Version ≥ 0.2.6 (July 7, 2022):

• gget ref now supports plant genomes! 🌱

Version ≥ 0.2.5 (June 30, 2022):

• NOTE: UniProt changed the structure of their API on June 28, 2022. Please upgrade to gget version ≥ 0.2.5 if you use any of the modules querying data from UniProt (gget info and gget seq).

Version ≥ 0.2.3: (June 26, 2022):

• JSON is now the default output format for the command-line interface for modules that previously returned data frame (CSV) format by default (the output can be converted to data frame/CSV using flag [-csv][--csv]). Data frame/CSV remains the default output for Jupyter Lab / Google Colab (and can be converted to JSON with json=True).
• For all modules, the first required argument was converted to a positional argument and should not be named anymore in the command-line, e.g. gget ref -s human → gget ref human.
• gget info: [--expand] is deprecated. The module will now always return all of the available information.
• Slight changes to the output returned by gget info, including the return of versioned Ensembl IDs.
• gget info and gget seq now support 🪱 WormBase and 🪰 FlyBase IDs.
• gget archs4 and gget enrichr now also take Ensembl IDs as input with added flag [-e][--ensembl] (ensembl=True in Jupyter Lab / Google Colab).
• gget seq argument seqtype was replaced by flag [-t][--translate] (translate=True/False in Jupyter Lab / Google Colab) which will return either nucleotide (False) or amino acid (True) sequences.
• gget search argument seqtype was renamed to id_type for clarity (still taking the same arguments 'gene' or 'transcript').

Active users of the gget website since its creation:

🧑‍🤝‍🧑 Dependents

The following applications build on gget:

• Therapeutics Data Commons (TDC)
  Artificial intelligence foundation for therapeutic science (source code, Nat Chem Bio paper) by Harvard's Artificial Intelligence for Medicine and Science lab.
• BioDiscoveryAgent
  BioDiscoveryAgent is an LLM-based AI agent for closed-loop design of genetic perturbation experiments (preprint) by the Stanford Network Analysis Project.
• DeepChopper
  Language models to identify chimeric artificial reads in NanoPore direct-RNA sequencing data by the Yang lab at Northwestern.
• BRAD
  A LLM powered chatbot for bioinformatics (documentation, project main page).
• scPRINT
  scPRINT is a large transformer model built for the inference of gene networks (connections between genes explaining the cell's expression profile) from scRNAseq data (preprint).
• AnoPrimer
  AnoPrimer is a Python package for primer design in An. gambiae and An. funestus, whilst considering genetic variation in wild whole-genome sequenced specimens in malariagen_data.
• AvaTaR
  Optimizing LLM Agents for Tool-Assisted Knowledge Retrieval (NeurIPS 2024) by James Zou Lab at Stanford University.
• GRLDrugProp
  Graph representation learning for modelling drug properties.
• Rust implementation of gget: https://github.com/noamteyssier/ggetrs
• https://github.com/Superbio-ai/getbio
• https://github.com/yonniejon/AchillesPrediction
• https://github.com/ELELAB/cancermuts
• https://github.com/Benoitdw/SNPrimer
• https://github.com/louisjoecodes/a16z-hackathon-project
• https://github.com/EvX57/BACE1-Drug-Discovery
• https://github.com/vecerkovakaterina/hidden-genes-msc
• https://github.com/vecerkovakaterina/llm_bioinfo_agent
• https://github.com/greedjar74/upstage_AI_Lab
• https://github.com/alphavector/all

Also see: https://github.com/pachterlab/gget/network/dependents

📃 Featured publications

• David Bradley et al., The fitness cost of spurious phosphorylation. The EMBO Journal (2024). DOI: 10.1038/s44318-024-00200-7
• Mikael Nilsson et al., Resolving thyroid lineage cell trajectories merging into a dual endocrine gland in mammals. Nature Portfolio (under review) (2024). DOI: 10.21203/rs.3.rs-5278325/v1
• Avasthi P et al., Repeat expansions associated with human disease are present in diverse organisms. Arcadia (2024). DOI: 10.57844/arcadia-e367-8b55
• Ibrahim Al Rayyes et al., Single-Cell Transcriptomics Reveals the Molecular Logic Underlying Ca2+ Signaling Diversity in Human and Mouse Brain. bioRxiv (2024). DOI: 10.1101/2024.04.26.591400
• David R. Blair & Neil Risch. Dissecting the Reduced Penetrance of Putative Loss-of-Function Variants in Population-Scale Biobanks. medRxiv (2024). DOI: 10.1101/2024.09.23.24314008
• Shanmugampillai Jeyarajaguru Kabilan et al., Molecular modelling approaches for the identification of potent Sodium-Glucose Cotransporter 2 inhibitors from Boerhavia diffusa for the potential treatment of chronic kidney disease. Journal of Computer-Aided Molecular Design (under review) (2024). DOI: 10.21203/rs.3.rs-4520611/v1
• Joseph M Rich et al., The impact of package selection and versioning on single-cell RNA-seq analysis. bioRxiv (2024). DOI: 10.1101/2024.04.04.588111
• Sanjay C. Nagi et al., AnoPrimer: Primer Design in malaria vectors informed by range-wide genomic variation. Wellcome Open Research (2024).
• Yasmin Makki Mohialden et al., A survey of the most recent Python packages for use in biology. NeuroQuantology (2023). DOI: 10.48047/NQ.2023.21.2.NQ23029
• Kimberly Siletti et al., Transcriptomic diversity of cell types across the adult human brain. Science (2023). DOI: 10.1126/science.add7046
• Beatriz Beamud et al., Genetic determinants of host tropism in Klebsiella phages. Cell Reports (2023). DOI: 10.1016/j.celrep.2023.112048
• Nicola A. Kearns et al., Generation and molecular characterization of human pluripotent stem cell-derived pharyngeal foregut endoderm. Cell Reports (2023). DOI: 10.1016/j.devcel.2023.08.024
• Jonathan Rosenski et al., Predicting gene knockout effects from expression data. BMC Medical Genomics (2023). DOI: 10.1186/s12920-023-01446-6
• Peter Overby et al., Pharmacological or genetic inhibition of Scn9a protects beta-cells while reducing insulin secretion in type 1 diabetes. bioRxiv (2023). DOI: 10.1101/2023.06.11.544521
• Mingze Dong et al., Deep identifiable modeling of single-cell atlases enables zero-shot query of cellular states. bioRxiv (2023). DOI: 10.1101/2023.11.11.566161

📰 News

• Documentary short film about gget: https://youtu.be/cVR0k6Mt97o
• Podcast episode for the Prototype Fund Public Interest Podcast about the importance of open-source software and its role in academic research (in German): https://public-interest-podcast.podigee.io/33-pips4e4
• Prototype Fund announcement: https://prototypefund.de/project/gget-genomische-datenbanken

Installation

pip install --upgrade gget

Alternative:

conda install -c bioconda gget

For use in Jupyter Lab / Google Colab:

import gget

🪄 Quick start guide

Command line:

# Fetch all Homo sapiens reference and annotation FTPs from the latest Ensembl release
$ gget ref homo_sapiens

# Get Ensembl IDs of human genes with "ace2" or "angiotensin converting enzyme 2" in their name/description
$ gget search -s homo_sapiens 'ace2' 'angiotensin converting enzyme 2'

# Look up gene ENSG00000130234 (ACE2) and its transcript ENST00000252519
$ gget info ENSG00000130234 ENST00000252519

# Fetch the amino acid sequence of the canonical transcript of gene ENSG00000130234
$ gget seq --translate ENSG00000130234

# Quickly find the genomic location of (the start of) that amino acid sequence
$ gget blat MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# BLAST (the start of) that amino acid sequence
$ gget blast MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# Align multiple nucleotide or amino acid sequences against each other (also accepts path to FASTA file)  
$ gget muscle MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS

# Align one or more amino acid sequences against a reference (containing one or more sequences) (local BLAST) (also accepts paths to FASTA files)  
$ gget diamond MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS -ref MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS  

# Use Enrichr for an ontology analysis of a list of genes
$ gget enrichr -db ontology ACE2 AGT AGTR1 ACE AGTRAP AGTR2 ACE3P

# Get the human tissue expression of gene ACE2
$ gget archs4 -w tissue ACE2

# Get the protein structure (in PDB format) of ACE2 as stored in the Protein Data Bank (PDB ID returned by gget info)
$ gget pdb 1R42 -o 1R42.pdb

# Find Eukaryotic Linear Motifs (ELMs) in a protein sequence
$ gget setup elm # setup only needs to be run once
$ gget elm -o results MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# Fetch a scRNAseq count matrix (AnnData format) based on specified gene(s), tissue(s), and cell type(s) (default species: human)
$ gget setup cellxgene # setup only needs to be run once
$ gget cellxgene --gene ACE2 SLC5A1 --tissue lung --cell_type 'mucus secreting cell' -o example_adata.h5ad

# Predict the protein structure of GFP from its amino acid sequence
$ gget setup alphafold # setup only needs to be run once
$ gget alphafold MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Python (Jupyter Lab / Google Colab):

import gget
gget.ref("homo_sapiens")
gget.search(["ace2", "angiotensin converting enzyme 2"], "homo_sapiens")
gget.info(["ENSG00000130234", "ENST00000252519"])
gget.seq("ENSG00000130234", translate=True)
gget.blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.muscle(["MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", "MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS"])
gget.diamond("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", reference="MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS")
gget.enrichr(["ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"], database="ontology", plot=True)
gget.archs4("ACE2", which="tissue")
gget.pdb("1R42", save=True)

gget.setup("elm") # setup only needs to be run once
ortho_df, regex_df = gget.elm("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")

gget.setup("cellxgene") # setup only needs to be run once
gget.cellxgene(gene = ["ACE2", "SLC5A1"], tissue = "lung", cell_type = "mucus secreting cell")

gget.setup("alphafold") # setup only needs to be run once
gget.alphafold("MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK")

Call gget from R using reticulate:

system("pip install gget")
install.packages("reticulate")
library(reticulate)
gget <- import("gget")

gget$ref("homo_sapiens")
gget$search(list("ace2", "angiotensin converting enzyme 2"), "homo_sapiens")
gget$info(list("ENSG00000130234", "ENST00000252519"))
gget$seq("ENSG00000130234", translate=TRUE)
gget$blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget$blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget$muscle(list("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", "MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS"), out="out.afa")
gget$diamond("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", reference="MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS")
gget$enrichr(list("ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"), database="ontology")
gget$archs4("ACE2", which="tissue")
gget$pdb("1R42", save=TRUE)

More examples

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget alphafold 🪢

Predict the 3D structure of a protein from its amino acid sequence using a simplified version of DeepMind’s AlphaFold2 originally released and benchmarked for AlphaFold Colab.
Returns: Predicted structure (PDB) and alignment error (json).

Before using gget alphafold for the first time:

1. Install the third-party dependency openmm v7.5.1 (or v7.7.0 for Python >= 3.10) by running the following command from the command line:
   conda install -qy conda==4.13.0 && conda install -qy -c conda-forge openmm=7.5.1
   (replace with openmm=7.7.0 for Python >= 3.10)
   Recommendation: Follow with conda update -qy conda to update conda to the latest version afterwards.
2. Run gget setup alphafold / gget.setup("alphafold") once (also see gget setup). Running gget setup alphafold / gget.setup("alphafold") will download and install the latest version of AlphaFold2 hosted on the AlphaFold GitHub Repo. You can rerun this command any time to update the software after a new AlphaFold release.

Positional argument
sequence
Amino acid sequence (str), or list of sequences (gget alphafold will automatically use the multimer model if multiple sequences are passed), or path to FASTA file.

Optional arguments
-mr --multimer_recycles
The multimer model will continue recycling until the predictions stop changing, up to the limit set here. Default: 3.
For higher accuracy, at the potential cost of longer inference times, set this to 20.

-o --out
Path to folder to save prediction results in (str). Default: "./[date_time]_gget_alphafold_prediction".

Flags
-mfm --multimer_for_monomer
Use multimer model for a monomer.

-r --relax
AMBER relax the best model.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

plot
Python only. plot=True provides an interactive, 3D graphical overview of the predicted structure and alignment quality using py3Dmol and matplotlib (default: True).

show_sidechains
Python only. show_sidechains=True includes side chains in the plot (default: True).

Example

# Generate new prediction from amino acid sequence
gget alphafold MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH

# Find similar sequences deposited on the PDB for comparative analysis
gget blast --database pdbaa MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH

# Fetch the PDB files of similar structures returned by gget blast for comparison, to get a measure for model quality
gget pdb 3UQ3 -o 3UQ3.pdb
gget pdb 2K42 -o 2K42.pdb

# Python
gget.alphafold("MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH")

# Find similar sequences deposited on the PDB for comparative analysis
gget.blast("MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH", database="pdbaa")

# Fetch the PDB files of similar structures returned by gget blast for comparison, to get a measure for model quality
gget.pdb("3UQ3", save=True)
gget.pdb("2K42", save=True)

→ gget alphafold returns the predicted structure (PDB) and predicted alignment error (.json) in a new folder ("./[date_time]_gget_alphafold_prediction"). The use case above exemplifies how to use gget blast and gget pdb for a comparative analysis of the new prediction. PDB files can be viewed interactively in 3D online, or using programs like PyMOL or Blender. To compare two PDB files, you can use this website. The Python interface also returns interactive plots, which can be generated from the PDB and JSON as described in the gget alphafold FAQ Q4.

Tutorials

🔗 Google Colab tutorial

🔗 Protein structure prediction with comparison to related crystal structures

🔗 gget alphafold FAQ

References

If you use gget alphafold in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Jumper, J., Evans, R., Pritzel, A. et al. Highly accurate protein structure prediction with AlphaFold. Nature 596, 583–589 (2021). https://doi.org/10.1038/s41586-021-03819-2

And, if applicable:

• Evans, R. et al. Protein complex prediction with AlphaFold-Multimer. bioRxiv 2021.10.04.463034; https://doi.org/10.1101/2021.10.04.463034

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget archs4 🐁

Find the most correlated genes to a gene of interest or find the gene's tissue expression atlas using ARCHS4.
Return format: JSON (command-line) or data frame/CSV (Python).

Positional argument
gene
Short name (gene symbol) of gene of interest, e.g. STAT4.
Alternatively: use flag --ensembl to input an Ensembl gene IDs, e.g. ENSG00000138378.

Optional arguments
-w --which
'correlation' (default) or 'tissue'.
'correlation' returns a gene correlation table that contains the 100 most correlated genes to the gene of interest. The Pearson correlation is calculated over all samples and tissues in ARCHS4.
'tissue' returns a tissue expression atlas calculated from human or mouse samples (as defined by 'species') in ARCHS4.

-s --species
'human' (default) or 'mouse'.
Defines whether to use human or mouse samples from ARCHS4.
(Only for tissue expression atlas.)

-o --out
Path to the file the results will be saved in, e.g. path/to/directory/results.csv (or .json). Default: Standard out.
Python: save=True will save the output in the current working directory.

Flags
-e --ensembl
Add this flag if gene is given as an Ensembl gene ID.

-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Examples

gget archs4 ACE2

# Python
gget.archs4("ACE2")

→ Returns the 100 most correlated genes to ACE2:

gget archs4 -w tissue ACE2

# Python
gget.archs4("ACE2", which="tissue")

→ Returns the tissue expression of ACE2 (by default, human data is used):

Check out this tutorial by Dave Tang who wrote an R script to create this figure from the gget archs4 JSON output:

More examples

References

If you use gget archs4 in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Lachmann A, Torre D, Keenan AB, Jagodnik KM, Lee HJ, Wang L, Silverstein MC, Ma’ayan A. Massive mining of publicly available RNA-seq data from human and mouse. Nature Communications 9. Article number: 1366 (2018), doi:10.1038/s41467-018-03751-6

• Bray NL, Pimentel H, Melsted P and Pachter L, Near optimal probabilistic RNA-seq quantification, Nature Biotechnology 34, p 525--527 (2016). https://doi.org/10.1038/nbt.3519

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget bgee 🐝

Fetch orthology and gene expression data from Bgee using Ensembl IDs.
Return format: JSON/CSV (command-line) or data frame (Python).

If you are specifically interested in human gene expression data, consider using gget opentargets or gget archs4 instead. gget bgee has less data, but supports more species.

This module was written by Sam Wagenaar.

Positional argument
ens_id
Ensembl gene ID, e.g. ENSG00000169194 or ENSSSCG00000014725.

NOTE: Some of the species in Bgee are not in Ensembl or Ensembl metazoa, and for those you can use NCBI gene IDs, e.g. 118215821 (a gene in Anguilla anguilla).

Required arguments
-t --type
Type of data to fetch. Options: orthologs, expression.

Optional arguments
-o --out
Path to the JSON file the results will be saved in, e.g. path/to/directory/results.json. Default: Standard out.

Flags
-csv --csv
Command-line only. Returns the output in CSV format, instead of JSON format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Examples

Get orthologs for a gene

gget bgee ENSSSCG00000014725 -t orthologs

import gget
gget.bgee("ENSSSCG00000014725", type="orthologs")

→ Returns orthologs for the gene with Ensembl ID ENSSSCG00000014725.

Get gene expression data for a gene

gget bgee ENSSSCG00000014725 -t expression

import gget
gget.bgee("ENSSSCG00000014725", type="expression")

→ Returns gene expression data for the gene with Ensembl ID ENSSSCG00000014725.

More examples

References

If you use gget bgee in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Frederic B Bastian, Julien Roux, Anne Niknejad, Aurélie Comte, Sara S Fonseca Costa, Tarcisio Mendes de Farias, Sébastien Moretti, Gilles Parmentier, Valentine Rech de Laval, Marta Rosikiewicz, Julien Wollbrett, Amina Echchiki, Angélique Escoriza, Walid H Gharib, Mar Gonzales-Porta, Yohan Jarosz, Balazs Laurenczy, Philippe Moret, Emilie Person, Patrick Roelli, Komal Sanjeev, Mathieu Seppey, Marc Robinson-Rechavi (2021). The Bgee suite: integrated curated expression atlas and comparative transcriptomics in animals. Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D831–D847, https://doi.org/10.1093/nar/gkaa793

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget blast 💥

BLAST a nucleotide or amino acid sequence to any BLAST database.
Return format: JSON (command-line) or data frame/CSV (Python).

Positional argument
sequence
Nucleotide or amino acid sequence, or path to FASTA or .txt file.

Optional arguments
-p --program
'blastn', 'blastp', 'blastx', 'tblastn', or 'tblastx'.
Default: 'blastn' for nucleotide sequences; 'blastp' for amino acid sequences.

-db --database
'nt', 'nr', 'refseq_rna', 'refseq_protein', 'swissprot', 'pdbaa', or 'pdbnt'.
Default: 'nt' for nucleotide sequences; 'nr' for amino acid sequences.
More info on BLAST databases

-l --limit
Limits number of hits to return. Default: 50.

-e --expect
Defines the expect value cutoff. Default: 10.0.

-o --out
Path to the file the results will be saved in, e.g. path/to/directory/results.csv (or .json). Default: Standard out.
Python: save=True will save the output in the current working directory.

Flags
-lcf --low_comp_filt
Turns on low complexity filter.

-mbo --megablast_off
Turns off MegaBLAST algorithm. Default: MegaBLAST on (blastn only).

-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

wrap_text
Python only. wrap_text=True displays data frame with wrapped text for easy reading (default: False).

Example

gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# Python
gget.blast("MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR")

→ Returns the BLAST result of the sequence of interest. gget blast automatically detects this sequence as an amino acid sequence and therefore sets the BLAST program to blastp with database nr.

BLAST from .fa or .txt file:

gget blast fasta.fa

# Python
gget.blast("fasta.fa")

→ Returns the BLAST results of the first sequence contained in the fasta.fa file.

More examples

References

If you use gget blast in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ. Basic local alignment search tool. J Mol Biol. 1990 Oct 5;215(3):403-10. doi: 10.1016/S0022-2836(05)80360-2. PMID: 2231712.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget blat 🎯

Find the genomic location of a nucleotide or amino acid sequence using BLAT.
Return format: JSON (command-line) or data frame/CSV (Python).

Positional argument
sequence
Nucleotide or amino acid sequence, or path to FASTA or .txt file.

Optional arguments
-st --seqtype
'DNA', 'protein', 'translated%20RNA', or 'translated%20DNA'.
Default: 'DNA' for nucleotide sequences; 'protein' for amino acid sequences.

-a --assembly
'human' (hg38) (default), 'mouse' (mm39), 'zebrafinch' (taeGut2),
or any of the species assemblies available here (use short assembly name).

-o --out
Path to the file the results will be saved in, e.g. path/to/directory/results.csv (or .json). Default: Standard out.
Python: save=True will save the output in the current working directory.

Flags
-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Example

gget blat -a taeGut2 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# Python
gget.blat("MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR", assembly="taeGut2")

→ Returns BLAT results for assembly taeGut2 (zebra finch). In the above example, gget blat automatically detects this sequence as an amino acid sequence and therefore sets the BLAT seqtype to protein.

More examples

References

If you use gget blat in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Kent WJ. BLAT--the BLAST-like alignment tool. Genome Res. 2002 Apr;12(4):656-64. doi: 10.1101/gr.229202. PMID: 11932250; PMCID: PMC187518.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget cbio 📖

Plot cancer genomics heatmaps using data from cBioPortal using Ensembl IDs or gene names.

This module was written by Sam Wagenaar.

Positional argument
subcommand
Either search or plot

search subcommand (Python: gget.cbio_search)

Find cBioPortal study IDs by keyword.
Return format: JSON (command-line) or string list (Python).
Note: This does not return studies with mixed cancer types.

Positional argument
keywords
Space-separated list of keywords to search for, e.g. breast lung.
Python: Pass keywords as a list of strings.

plot subcommand (Python: gget.cbio_plot)

Plot cancer genomics heatmaps using data from cBioPortal. Return format: PNG (command-line and Python)

Required arguments
-s --study_ids
Space-separated list of cBioPortal study IDs, e.g. msk_impact_2017 egc_msk_2023.

-g --genes
Space-separated list of gene names or Ensembl IDs, e.g. NOTCH3 ENSG00000108375.

Optional arguments
-st --stratification
Column to stratify the data by. Default: tissue.
Options:

• tissue
• cancer_type
• cancer_type_detailed
• study_id
• sample

-vt --variation_type
Type of variation to plot. Default: mutation_occurrences.
Options:

• mutation_occurrences
• cna_nonbinary (Note: stratification must be 'sample' for this option)
• sv_occurrences
• cna_occurrences
• Consequence (Note: stratification must be 'sample' for this option)

-f --filter
Filter the data by a specific value in a specific column, e.g. study_id:msk_impact_2017
Python: filter=(column, value)

-dd --data_dir
Directory to store data files. Default: ./gget_cbio_cache.

-fd --figure_dir
Directory to output figures. Default: ./gget_cbio_figures.

-fn --filename
Filename for the output figure, relative to figure_dir. Default: auto-generated
Python: figure_filename

-t --title
Title for the output figure. Default: auto-generated
Python: figure_title

-dpi --dpi
DPI of the output figure. Default: 100.

Flags

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

-nc --no_confirm
Command-line only. Skip download confirmation prompts.
Python: Use confirm_download=True to enable download confirmation prompts.

-sh --show
Show the plot in a window (automatic in Jupyter notebooks).

Examples

Find all cBioPortal studies with cancer types matching specific keywords:

gget cbio search esophag ovary ovarian

# Python
import gget
gget.cbio_search(['esophag', 'ovary', 'ovarian'])

→ Returns a list of studies with cancer types matching the keywords esophag, ovary, or ovarian.

['egc_tmucih_2015', 'egc_msk_2017', ..., 'msk_spectrum_tme_2022']

Plot a heatmap of mutation occurrences for specific genes in a specific study:

gget cbio plot \
    -s msk_impact_2017 \
    -g AKT1 ALK FLT4 MAP3K1 MLL2 MLL3 NOTCH3 NOTCH4 PDCD1 RNF43 \
    -st tissue \
    -vt mutation_occurrences \
    -dpi 200 \
    -y

# Python
import gget
gget.cbio_plot(
    ['msk_impact_2017'],
    ['AKT1', 'ALK', 'FLT4', 'MAP3K1', 'MLL2', 'MLL3', 'NOTCH3', 'NOTCH4', 'PDCD1', 'RNF43'],
    stratification='tissue',
    variation_type='mutation_occurrences',
    dpi=200
)

→ Saves a heatmap of mutation occurrences for the specified genes in the specified study to ./gget_cbio_figures/Heatmap_tissue.png.

Plot a heatmap of mutation types for specific genes in a specific study:

gget cbio plot \
    -s msk_impact_2017 \
    -g AKT1 ALK FLT4 MAP3K1 MLL2 MLL3 NOTCH3 NOTCH4 PDCD1 RNF43 \
    -st sample \
    -vt Consequence \
    -dpi 200 \
    -y

# Python
import gget
gget.cbio_plot(
    ['msk_impact_2017'],
    ['AKT1', 'ALK', 'FLT4', 'MAP3K1', 'MLL2', 'MLL3', 'NOTCH3', 'NOTCH4', 'PDCD1', 'RNF43'],
    stratification='sample',
    variation_type='Consequence',
    dpi=200,
)

→ Saves a heatmap of mutation types for the specified genes in the specified study to ./gget_cbio_figures/Heatmap_sample.png.

Plot a heatmap of mutation types for specific genes in a specific study, filtering by tissue:

gget cbio plot \
    -s msk_impact_2017 \
    -g AKT1 ALK FLT4 MAP3K1 MLL2 MLL3 NOTCH3 NOTCH4 PDCD1 RNF43 \
    -st sample \
    -vt Consequence \
    -f tissue:intestine \
    -dpi 200 \
    -y

# Python
import gget
gget.cbio_plot(
    ['msk_impact_2017'],
    ['AKT1', 'ALK', 'FLT4', 'MAP3K1', 'MLL2', 'MLL3', 'NOTCH3', 'NOTCH4', 'PDCD1', 'RNF43'],
    stratification='sample',
    variation_type='Consequence',
    filter=('tissue', 'intestine'),
    dpi=200,
)

→ Saves a heatmap of mutation types for the specified genes in the specified study, filtered by tissue, to ./gget_cbio_figures/Heatmap_sample_intestine.png.

Plot a heatmap with a custom title and filename:

gget cbio plot \
    -s msk_impact_2017 \
    -g AKT1 ALK FLT4 MAP3K1 MLL2 MLL3 NOTCH3 NOTCH4 PDCD1 RNF43 \
    -st sample \
    -vt Consequence \
    -f tissue:intestine \
    -dpi 200 \
    -y \
    -t "Intestinal Mutations" \
    -fn intestinal_mutations.png

# Python
import gget
gget.cbio_plot(
    ['msk_impact_2017'],
    ['AKT1', 'ALK', 'FLT4', 'MAP3K1', 'MLL2', 'MLL3', 'NOTCH3', 'NOTCH4', 'PDCD1', 'RNF43'],
    stratification='sample',
    variation_type='Consequence',
    filter=('tissue', 'intestine'),
    dpi=200,
    figure_title='Intestinal Mutations',
    figure_filename='intestinal_mutations.png'
)

→ Saves a heatmap of mutation types for the specified genes in the specified study, filtered by tissue, with the title "Intestinal Mutations" to ./gget_cbio_figures/intestinal_mutations.png.

More examples

References

If you use gget cbio in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Cerami E, Gao J, Dogrusoz U, Gross BE, Sumer SO, Aksoy BA, Jacobsen A, Byrne CJ, Heuer ML, Larsson E, Antipin Y, Reva B, Goldberg AP, Sander C, Schultz N. The cBio cancer genomics portal: an open platform for exploring multidimensional cancer genomics data. Cancer Discov. 2012 May;2(5):401-4. doi: 10.1158/2159-8290.CD-12-0095. Erratum in: Cancer Discov. 2012 Oct;2(10):960. PMID: 22588877; PMCID: PMC3956037.

• Gao J, Aksoy BA, Dogrusoz U, Dresdner G, Gross B, Sumer SO, Sun Y, Jacobsen A, Sinha R, Larsson E, Cerami E, Sander C, Schultz N. Integrative analysis of complex cancer genomics and clinical profiles using the cBioPortal. Sci Signal. 2013 Apr 2;6(269):pl1. doi: 10.1126/scisignal.2004088. PMID: 23550210; PMCID: PMC4160307.

• de Bruijn I, Kundra R, Mastrogiacomo B, Tran TN, Sikina L, Mazor T, Li X, Ochoa A, Zhao G, Lai B, Abeshouse A, Baiceanu D, Ciftci E, Dogrusoz U, Dufilie A, Erkoc Z, Garcia Lara E, Fu Z, Gross B, Haynes C, Heath A, Higgins D, Jagannathan P, Kalletla K, Kumari P, Lindsay J, Lisman A, Leenknegt B, Lukasse P, Madela D, Madupuri R, van Nierop P, Plantalech O, Quach J, Resnick AC, Rodenburg SYA, Satravada BA, Schaeffer F, Sheridan R, Singh J, Sirohi R, Sumer SO, van Hagen S, Wang A, Wilson M, Zhang H, Zhu K, Rusk N, Brown S, Lavery JA, Panageas KS, Rudolph JE, LeNoue-Newton ML, Warner JL, Guo X, Hunter-Zinck H, Yu TV, Pilai S, Nichols C, Gardos SM, Philip J; AACR Project GENIE BPC Core Team, AACR Project GENIE Consortium; Kehl KL, Riely GJ, Schrag D, Lee J, Fiandalo MV, Sweeney SM, Pugh TJ, Sander C, Cerami E, Gao J, Schultz N. Analysis and Visualization of Longitudinal Genomic and Clinical Data from the AACR Project GENIE Biopharma Collaborative in cBioPortal. Cancer Res. 2023 Dec 1;83(23):3861-3867. doi: 10.1158/0008-5472.CAN-23-0816. PMID: 37668528; PMCID: PMC10690089.

• Please also cite the source of the data if you are using a publicly available dataset.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget cellxgene 🍱

Query data from CZ CELLxGENE Discover using the CZ CELLxGENE Discover Census. CZ CELLxGENE Discover provides ready-to-use single-cell RNA sequencing count matrices for certain tissues/diseases/genes/etc.

Returns: An AnnData object containing the count matrix and metadata of single-cell RNA sequencing data from the defined tissues/genes/etc.

Before using gget cellxgene for the first time, run gget setup cellxgene / gget.setup("cellxgene") once (also see gget setup).

Optional arguments
-s --species
Choice of 'homo_sapiens' or 'mus_musculus'. Default: 'homo_sapiens'.

-g --gene
Str or list of gene name(s) or Ensembl ID(s). Default: None.
NOTE: Use -e / --ensembl (Python: ensembl=True) when providing Ensembl ID(s) instead of gene name(s).
See https://cellxgene.cziscience.com/gene-expression for examples of available genes.

-cv --census_version
Str defining version of Census, e.g. "2023-05-15", or "latest" or "stable". Default: "stable".

-cn --column_names
List of metadata columns to return (stored in AnnData.obs).
Default: ['dataset_id', 'assay', 'suspension_type', 'sex', 'tissue_general', 'tissue', 'cell_type']
For more options, see: https://api.cellxgene.cziscience.com/curation/ui/#/ -> Schemas -> dataset

-o --out
Path to file to save generated AnnData .h5ad file (or .csv with -mo / --meta_only).
Required when using from command line!

Flags
-e --ensembl
Use when genes are provided as Ensembl IDs instead of gene names.

-mo --meta_only
Only returns metadata data frame (corresponds to AnnData.obs).

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Optional arguments corresponding to CZ CELLxGENE Discover metadata attributes
--tissue
Str or list of tissue(s), e.g. ['lung', 'blood']. Default: None.
See https://cellxgene.cziscience.com/gene-expression for examples of available tissues.

--cell_type
Str or list of cell type (s), e.g. ['mucus secreting cell', 'neuroendocrine cell']. Default: None.
See https://cellxgene.cziscience.com/gene-expression and select a tissue to see examples of available cell types.

--development_stage
Str or list of development stage(s). Default: None.

--disease
Str or list of disease(s). Default: None.

--sex
Str or list of sex(es), e.g. 'female'. Default: None.

--dataset_id
Str or list of CELLxGENE dataset ID(s). Default: None.

--tissue_general_ontology_term_id
Str or list of high-level tissue UBERON ID(s). Default: None.
Tissue labels and their corresponding UBERON IDs are listed here.

--tissue_general
Str or list of high-level tissue label(s). Default: None.
Tissue labels and their corresponding UBERON IDs are listed here.

--tissue_ontology_term_id
Str or list of tissue ontology term ID(s) as defined in the CELLxGENE dataset schema. Default: None.

--assay_ontology_term_id
Str or list of assay ontology term ID(s) as defined in the CELLxGENE dataset schema. Default: None.

--assay
Str or list of assay(s) as defined in the CELLxGENE dataset schema. Default: None.

--cell_type_ontology_term_id
Str or list of cell type ontology term ID(s) as defined in the CELLxGENE dataset schema. Default: None.

--development_stage_ontology_term_id
Str or list of development stage ontology term ID(s) as defined in the CELLxGENE dataset schema. Default: None.

--disease_ontology_term_id
Str or list of disease ontology term ID(s) as defined in the CELLxGENE dataset schema. Default: None.

--donor_id
Str or list of donor ID(s) as defined in the CELLxGENE dataset schema. Default: None.

--self_reported_ethnicity_ontology_term_id
Str or list of self-reported ethnicity ontology ID(s) as defined in the CELLxGENE dataset schema. Default: None.

--self_reported_ethnicity
Str or list of self-reported ethnicity as defined in the CELLxGENE dataset schema. Default: None.

--sex_ontology_term_id
Str or list of sex ontology ID(s) as defined in the CELLxGENE dataset schema. Default: None.

--suspension_type
Str or list of suspension type(s) as defined in the CELLxGENE dataset schema. Default: None.

Examples

gget cellxgene --gene ACE2 ABCA1 SLC5A1 --tissue lung --cell_type 'mucus secreting cell' 'neuroendocrine cell' -o example_adata.h5ad

# Python
adata = gget.cellxgene(
    gene = ["ACE2", "ABCA1", "SLC5A1"],
    tissue = "lung",
    cell_type = ["mucus secreting cell", "neuroendocrine cell"]
)
adata

→ Returns an AnnData object containing the scRNAseq ACE2, ABCA1, and SLC5A1 count matrix of 3322 human lung mucus secreting and neuroendocrine cells from CZ CELLxGENE Discover and their corresponding metadata.

Fetch metadata (corresponds to AnnData.obs) only:

gget cellxgene --meta_only --gene ENSMUSG00000015405 --ensembl --tissue lung --species mus_musculus -o example_meta.csv

# Python
df = gget.cellxgene(
    meta_only = True,
    gene = "ENSMUSG00000015405",
    ensembl = True,
    tissue = "lung",  
    species = "mus_musculus"
)
df

→ Returns only the metadata from ENSMUSG00000015405 (ACE2) expression datasets corresponding to mouse lung cells.

Also see: https://chanzuckerberg.github.io/cellxgene-census/notebooks/api_demo/census_gget_demo.html

References

If you use gget cellxgene in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Chanzuckerberg Initiative. (n.d.). CZ CELLxGENE Discover. Retrieved [insert date here], from https://cellxgene.cziscience.com/

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget cosmic 🪐

Search for genes, mutations, and other factors associated with cancer using the COSMIC (Catalogue Of Somatic Mutations In Cancer) database.
Return format: JSON (command-line) or data frame/CSV (Python) when download_cosmic=False. When download_cosmic=True, downloads the requested database into the specified folder.

This module was written in part by @AubakirovArman (information querying) and @josephrich98 (database download).

NOTE: License fees apply for the commercial use of COSMIC. You can read more about licensing COSMIC data here.

Positional argument (for querying information)
searchterm
Search term, which can be a mutation, or gene name (or Ensembl ID), or sample, etc.
Examples for the searchterm and entitity arguments:

NOTE: (Python only) Set to None when downloading COSMIC databases with download_cosmic=True.

Optional arguments (for querying information)
-e --entity
'mutations' (default), 'genes', 'cancer', 'tumour site', 'studies', 'pubmed', or 'samples'.
Defines the type of the results to return.

-l --limit
Limits number of hits to return. Default: 100.

Flags (for downloading COSMIC databases)
-d --download_cosmic
Switches into database download mode.

-gm --gget_mutate
TURNS OFF creation of a modified version of the database for use with gget mutate.
Python: gget_mutate is True by default. Set gget_mutate=False to disable.

Optional arguments (for downloading COSMIC databases)
-mc --mutation_class
'cancer' (default), 'cell_line', 'census', 'resistance', 'genome_screen', 'targeted_screen', or 'cancer_example'
Type of COSMIC database to download.

-cv --cosmic_version
Version of the COSMIC database. Default: None -> Defaults to latest version.

-gv --grch_version
Version of the human GRCh reference genome the COSMIC database was based on (37 or 38). Default: 37

--keep_genome_info Whether to keep genome information in the modified database for use with gget mutate. Default: False

--remove_duplicates Whether to remove duplicate rows from the modified database for use with gget mutate. Default: False

Optional arguments (general)
-o --out
Path to the file (or folder when downloading databases with the download_cosmic flag) the results will be saved in, e.g. 'path/to/results.json'.
Default: None
-> When download_cosmic=False: Results will be returned to standard out
-> When download_cosmic=True: Database will be downloaded into current working directory

Flags (general)
-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Examples

Query information

gget cosmic EGFR

# Python
gget.cosmic("EGFR")

→ Returns mutations in the EGFR gene that are associated with cancer in the format:

Downloading COSMIC databases

gget cosmic --download_cosmic

# Python
gget.cosmic(searchterm=None, download_cosmic=True)

→ Downloads the COSMIC cancer database of the latest COSMIC release into the current working directory.

References

If you use gget cosmic in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Tate JG, Bamford S, Jubb HC, Sondka Z, Beare DM, Bindal N, Boutselakis H, Cole CG, Creatore C, Dawson E, Fish P, Harsha B, Hathaway C, Jupe SC, Kok CY, Noble K, Ponting L, Ramshaw CC, Rye CE, Speedy HE, Stefancsik R, Thompson SL, Wang S, Ward S, Campbell PJ, Forbes SA. COSMIC: the Catalogue Of Somatic Mutations In Cancer. Nucleic Acids Res. 2019 Jan 8;47(D1):D941-D947. doi: 10.1093/nar/gky1015. PMID: 30371878; PMCID: PMC6323903.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget diamond 💎

Align multiple protein or translated DNA sequences using DIAMOND (DIAMOND is similar to BLAST, but this is a local computation).
Return format: JSON (command-line) or data frame/CSV (Python).

Positional argument
query
Sequences (str or list) or path to FASTA file containing sequences to be aligned against the reference.

Required arguments
-ref --reference
Reference sequences (str or list) or path to FASTA file containing reference sequences.

Optional arguments
-db --diamond_db
Path to save DIAMOND database created from reference (str).
Default: None -> Temporary db file will be deleted after alignment or saved in out if out is provided.

-s --sensitivity
Sensitivity of alignment (str). Default: "very-sensitive".
One of the following: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive, or ultra-sensitive.

-t --threads
Number of threads used (int). Default: 1.

-db --diamond_binary
Path to DIAMOND binary (str). Default: None -> Uses DIAMOND binary installed with gget.

-o --out
Path to the folder to save results in (str), e.g. "path/to/directory". Default: Standard out; temporary files are deleted.

Flags
-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Example

# !!! Make sure to list the positional argument first here so it is not added as a reference sequence
gget diamond GGETISAWESQME ELVISISALIVE LQVEFRANKLIN PACHTERLABRQCKS -ref GGETISAWESQMEELVISISALIVELQVEFRANKLIN PACHTERLABRQCKS

# Python
gget.diamond(["GGETISAWESQME", "ELVISISALIVE", "LQVEFRANKLIN", "PACHTERLABRQCKS"], reference=["GGETISAWESQMEELVISISALIVELQVEFRANKLIN", "PACHTERLABRQCKS"])

→ Returns results in JSON (command-line) or data frame/CSV (Python) format:

More examples

References

If you use gget diamond in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Buchfink, B., Xie, C. & Huson, D. Fast and sensitive protein alignment using DIAMOND. Nat Methods 12, 59–60 (2015). https://doi.org/10.1038/nmeth.3176

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget elm 🎭

Locally predict Eukaryotic Linear Motifs from an amino acid sequence or UniProt Acc using data from the ELM database.
Return format: JSON (command-line) or data frame/CSV (Python). This module returns two data frames (or JSON formatted files) (see examples).

ELM data can be downloaded & distributed for non-commercial use according to the ELM Software License Agreement.

Before using gget elm for the first time, run gget setup elm (bash) / gget.setup("elm") (Python) once (also see gget setup).

Positional argument
sequence
Amino acid sequence or Uniprot Acc (str).
When providing a Uniprot Acc, use flag --uniprot (Python: uniprot=True).

Optional arguments
-s --sensitivity
Sensitivity of DIAMOND alignment (str). Default: "very-sensitive".
One of the following: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive, or ultra-sensitive.

-t --threads
Number of threads used in DIAMOND alignment (int). Default: 1.

-bin --diamond_binary
Path to DIAMOND binary (str). Default: None -> Uses DIAMOND binary installed with gget.

-o --out
Path to the folder to save results in (str), e.g. "path/to/directory". Default: Standard out; temporary files are deleted.

Flags
-u --uniprot
Set to True if sequence is a Uniprot Acc instead of an amino acid sequence.

-e --expand
Expand the information returned in the regex data frame to include the protein names, organisms, and references that the motif was orignally validated on.

-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Examples

Find ELMs in an amino acid sequence:

gget setup elm          # Downloads/updates local ELM database
gget elm -o gget_elm_results LIAQSIGQASFV

# Python
gget.setup(“elm”)      # Downloads/updates local ELM database
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")

Find ELMs giving a UniProt Acc as input:

gget setup elm          # Downloads/updates local ELM database
gget elm -o gget_elm_results --uniprot Q02410 -e

# Python
gget.setup(“elm”)      # Downloads/updates local ELM database
ortholog_df, regex_df = gget.elm("Q02410", uniprot=True, expand=True)

→ Returns two data frames (or JSON formatted dictionaries for command line) containing extensive information about linear motifs associated with orthologous proteins and motifs found in the input sequence directly based on their regex expressions:

ortholog_df:

regex_df:

Tutorials

🔗 General gget elm demo

🔗 A point mutation in BRCA2 is carcinogenic due to the loss of a protein interaction motif

🔗 Filter gget elm results based on disordered protein regions

References

If you use gget elm in a publication, please cite the following articles:

• Laura Luebbert, Chi Hoang, Manjeet Kumar, Lior Pachter, Fast and scalable querying of eukaryotic linear motifs with gget elm, Bioinformatics, 2024, btae095, https://doi.org/10.1093/bioinformatics/btae095

• Manjeet Kumar, Sushama Michael, Jesús Alvarado-Valverde, Bálint Mészáros, Hugo Sámano‐Sánchez, András Zeke, Laszlo Dobson, Tamas Lazar, Mihkel Örd, Anurag Nagpal, Nazanin Farahi, Melanie Käser, Ramya Kraleti, Norman E Davey, Rita Pancsa, Lucía B Chemes, Toby J Gibson, The Eukaryotic Linear Motif resource: 2022 release, Nucleic Acids Research, Volume 50, Issue D1, 7 January 2022, Pages D497–D508, https://doi.org/10.1093/nar/gkab975

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget enrichr 💰

Perform an enrichment analysis on a list of genes using Enrichr or modEnrichr.
Return format: JSON (command-line) or data frame/CSV (Python).

Positional argument
genes
Short names (gene symbols) of genes to perform enrichment analysis on, e.g. PHF14 RBM3 MSL1 PHF21A.
Alternatively: use flag --ensembl to input a list of Ensembl gene IDs, e.g. ENSG00000106443 ENSG00000102317 ENSG00000188895.

Other required arguments
-db --database
Database database to use as reference for the enrichment analysis.
Supports any database listed here under 'Gene-set Library' or one of the following shortcuts:
'pathway'       (KEGG_2021_Human)
'transcription'     (ChEA_2016)
'ontology'      (GO_Biological_Process_2021)
'diseases_drugs'   (GWAS_Catalog_2019)
'celltypes'      (PanglaoDB_Augmented_2021)
'kinase_interactions'  (KEA_2015)

NOTE: database shortcuts are not supported for species other than 'human' or 'mouse'. Click on the species databases listed below under species to view a list of databases available for each species.

Optional arguments
-s --species
Species to use as reference for the enrichment analysis. (Default: human)
Options:

-bkg_l --background_list
Short names (gene symbols) of background genes to perform enrichment analysis on, e.g. NSUN3 POLRMT NLRX1.
Alternatively: use flag --ensembl_background to input a list of Ensembl gene IDs.
See this Tweetorial to learn why you should use a background gene list when performing an enrichment analysis.

-o --out
Path to the file the results will be saved in, e.g. path/to/directory/results.csv (or .json). (Default: Standard out.)
Python: save=True will save the output in the current working directory.

-ko --kegg_out
Path to the png file the marked KEGG pathway images will be saved in, e.g. path/to/directory/pathway.png. (Default: None)

-kr --kegg_rank
Rank of the KEGG pathway to be plotted. (Default: 1)

figsize
Python only. (width, height) of plot in inches. (Default: (10,10))

ax
Python only. Pass a matplotlib axes object for plot customization. (Default: None)

Flags
-e --ensembl
Add this flag if genes are given as Ensembl gene IDs.

-e_b --ensembl_background
Add this flag if background_list are given as Ensembl gene IDs.

-bkg --background
If True, use set of > 20,000 default background genes listed here.

-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

plot
Python only. plot=True provides a graphical overview of the first 15 results (default: False).

Examples

gget enrichr -db ontology ACE2 AGT AGTR1

# Python
gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)

→ Returns pathways/functions involving genes ACE2, AGT, and AGTR1 from the GO Biological Process 2021 database. In Python, plot=True returns a graphical overview of the results:

Use gget enrichr with a background gene list:
See this Tweetorial to learn why you should use a background gene list when performing an enrichment analysis.

# Here, we are passing the input genes first (positional argument 'genes'), so they are not added to the background gene list behind the '-bkgr_l' argument
gget enrichr \
	PHF14 RBM3 MSL1 PHF21A ARL10 INSR JADE2 P2RX7 LINC00662 CCDC101 PPM1B KANSL1L CRYZL1 ANAPC16 TMCC1 CDH8 RBM11 CNPY2 HSPA1L CUL2 PLBD2 LARP7 TECPR2 ZNF302 CUX1 MOB2 CYTH2 SEC22C EIF4E3 ROBO2 ADAMTS9-AS2 CXXC1 LINC01314 ATF7 ATP5F1 \
	-db ChEA_2022 \
	-bkg_l NSUN3 POLRMT NLRX1 SFXN5 ZC3H12C SLC25A39 ARSG DEFB29 PCMTD2 ACAA1A LRRC1 2810432D09RIK SEPHS2 SAC3D1 TMLHE LOC623451 TSR2 PLEKHA7 GYS2 ARHGEF12 HIBCH LYRM2 ZBTB44 ENTPD5 RAB11FIP2 LIPT1 INTU ANXA13 KLF12 SAT2 GAL3ST2 VAMP8 FKBPL AQP11 TRAP1 PMPCB TM7SF3 RBM39 BRI3 KDR ZFP748 NAP1L1 DHRS1 LRRC56 WDR20A STXBP2 KLF1 UFC1 CCDC16 9230114K14RIK RWDD3 2610528K11RIK ACO1 CABLES1 LOC100047214 YARS2 LYPLA1 KALRN GYK ZFP787 ZFP655 RABEPK ZFP650 4732466D17RIK EXOSC4 WDR42A GPHN 2610528J11RIK 1110003E01RIK MDH1 1200014M14RIK AW209491 MUT 1700123L14RIK 2610036D13RIK PHF14 RBM3 MSL1 PHF21A ARL10 INSR JADE2 P2RX7 LINC00662 CCDC101 PPM1B KANSL1L CRYZL1 ANAPC16 TMCC1 CDH8 RBM11 CNPY2 HSPA1L CUL2 PLBD2 LARP7 TECPR2 ZNF302 CUX1 MOB2 CYTH2 SEC22C EIF4E3 ROBO2 ADAMTS9-AS2 CXXC1 LINC01314 ATF7 ATP5F1COX15 TMEM30A NSMCE4A TM2D2 RHBDD3 ATXN2 NFS1 3110001I20RIK BC038156 C330002I19RIK ZFYVE20 POLI TOMM70A LOC100047782 2410012H22RIK RILP A230062G08RIK PTTG1IP RAB1 AFAP1L1 LYRM5 2310026E23RIK SLC7A6OS MAT2B 4932438A13RIK LRRC8A SMO NUPL2

# Python
gget.enrichr(
	genes = [
		"PHF14", "RBM3", "MSL1", "PHF21A", "ARL10", "INSR", "JADE2", "P2RX7",
		"LINC00662", "CCDC101", "PPM1B", "KANSL1L", "CRYZL1", "ANAPC16", "TMCC1",
		"CDH8", "RBM11", "CNPY2", "HSPA1L", "CUL2", "PLBD2", "LARP7", "TECPR2", 
		"ZNF302", "CUX1", "MOB2", "CYTH2", "SEC22C", "EIF4E3", "ROBO2",
		"ADAMTS9-AS2", "CXXC1", "LINC01314", "ATF7", "ATP5F1"
	], 
	database = "ChEA_2022",
	background_list = [
		"NSUN3","POLRMT","NLRX1","SFXN5","ZC3H12C","SLC25A39","ARSG",
		"DEFB29","PCMTD2","ACAA1A","LRRC1","2810432D09RIK","SEPHS2",
		"SAC3D1","TMLHE","LOC623451","TSR2","PLEKHA7","GYS2","ARHGEF12",
		"HIBCH","LYRM2","ZBTB44","ENTPD5","RAB11FIP2","LIPT1",
		"INTU","ANXA13","KLF12","SAT2","GAL3ST2","VAMP8","FKBPL",
		"AQP11","TRAP1","PMPCB","TM7SF3","RBM39","BRI3","KDR","ZFP748",
		"NAP1L1","DHRS1","LRRC56","WDR20A","STXBP2","KLF1","UFC1",
		"CCDC16","9230114K14RIK","RWDD3","2610528K11RIK","ACO1",
		"CABLES1", "LOC100047214","YARS2","LYPLA1","KALRN","GYK",
		"ZFP787","ZFP655","RABEPK","ZFP650","4732466D17RIK","EXOSC4",
		"WDR42A","GPHN","2610528J11RIK","1110003E01RIK","MDH1","1200014M14RIK",
		"AW209491","MUT","1700123L14RIK","2610036D13RIK",
		"PHF14", "RBM3", "MSL1", "PHF21A", "ARL10", "INSR", "JADE2", 
		"P2RX7", "LINC00662", "CCDC101", "PPM1B", "KANSL1L", "CRYZL1", 
		"ANAPC16", "TMCC1","CDH8", "RBM11", "CNPY2", "HSPA1L", "CUL2", 
		"PLBD2", "LARP7", "TECPR2", "ZNF302", "CUX1", "MOB2", "CYTH2", 
		"SEC22C", "EIF4E3", "ROBO2", "ADAMTS9-AS2", "CXXC1", "LINC01314", "ATF7", 
		"ATP5F1""COX15","TMEM30A","NSMCE4A","TM2D2","RHBDD3","ATXN2","NFS1",
		"3110001I20RIK","BC038156","C330002I19RIK","ZFYVE20","POLI","TOMM70A",
		"LOC100047782","2410012H22RIK","RILP","A230062G08RIK",
		"PTTG1IP","RAB1","AFAP1L1", "LYRM5","2310026E23RIK",
		"SLC7A6OS","MAT2B","4932438A13RIK","LRRC8A","SMO","NUPL2"
	],
	plot=True
)

→ Returns hits of the input gene list given the background gene list from the transcription factor/target library ChEA 2022. In Python, plot=True returns a graphical overview of the results:

Generate a KEGG pathway image with the genes from the enrichment analysis highlighted:
This feature is available thanks to a PR by Noriaki Sato.

gget enrichr -db pathway --kegg_out kegg.png --kegg_rank 1 ZBP1 IRF3 RIPK1

# Python
gget.enrichr(["ZBP1", "IRF3", "RIPK1"], database="pathway", kegg_out="kegg.png", kegg_rank=1)

→ In addition to the standard gget enrichr output, the kegg_out argument saves an image with the genes from the enrichment analysis highlighted in the KEGG pathway:

The following example was submitted by Dylan Lawless via PR:
Use gget enrichr in R and create a similar plot using ggplot.
NOTE the switch of axes compared to the Python plot.

system("pip install gget")
install.packages("reticulate")
library(reticulate)
gget <- import("gget")

# Perform enrichment analysis on a list of genes
df <- gget$enrichr(list("ACE2", "AGT", "AGTR1"), database = "ontology")

# Count number of overlapping genes
df$overlapping_genes_count <- lapply(df$overlapping_genes, length) |> as.numeric()

# Only keep the top 15 results
df <- df[1:15, ]

# Plot
library(ggplot2)

df |>
	ggplot() +
	geom_bar(aes(
		x = -log10(adj_p_val),
		y = reorder(path_name, -adj_p_val)
	),
	stat = "identity",
  	fill = "lightgrey",
  	width = 0.5,
	color = "black") +
	geom_text(
		aes(
			y = path_name,
			x = (-log10(adj_p_val)),
			label = overlapping_genes_count
		),
		nudge_x = 0.75,
		show.legend = NA,
		color = "red"
	) +
  	geom_text(
		aes(
			y = Inf,
			x = Inf,
      			hjust = 1,
      			vjust = 1,
			label = "# of overlapping genes"
		),
		show.legend = NA,
		color = "red"
	) +
	geom_vline(linetype = "dotted", linewidth = 1, xintercept = -log10(0.05)) +
	ylab("Pathway name") +
	xlab("-log10(adjusted P value)")

Tutorials

Using gget enrichr with background genes

References

If you use gget enrichr in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Chen EY, Tan CM, Kou Y, Duan Q, Wang Z, Meirelles GV, Clark NR, Ma'ayan A. Enrichr: interactive and collaborative HTML5 gene list enrichment analysis tool. BMC Bioinformatics. 2013; 128(14). https://doi.org/10.1186/1471-2105-14-128

• Kuleshov MV, Jones MR, Rouillard AD, Fernandez NF, Duan Q, Wang Z, Koplev S, Jenkins SL, Jagodnik KM, Lachmann A, McDermott MG, Monteiro CD, Gundersen GW, Ma'ayan A. Enrichr: a comprehensive gene set enrichment analysis web server 2016 update. Nucleic Acids Research. 2016; gkw377. doi: 10.1093/nar/gkw377

• Xie Z, Bailey A, Kuleshov MV, Clarke DJB., Evangelista JE, Jenkins SL, Lachmann A, Wojciechowicz ML, Kropiwnicki E, Jagodnik KM, Jeon M, & Ma’ayan A. Gene set knowledge discovery with Enrichr. Current Protocols, 1, e90. 2021. doi: 10.1002/cpz1.90.

If working with non-human/mouse datasets, please also cite:

• Kuleshov MV, Diaz JEL, Flamholz ZN, Keenan AB, Lachmann A, Wojciechowicz ML, Cagan RL, Ma'ayan A. modEnrichr: a suite of gene set enrichment analysis tools for model organisms. Nucleic Acids Res. 2019 Jul 2;47(W1):W183-W190. doi: 10.1093/nar/gkz347. PMID: 31069376; PMCID: PMC6602483.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget gpt 💬

Generates natural language text based on a given prompt using the OpenAI API's 'openai.ChatCompletion.create' endpoint. This module, including its source code, documentation and unit tests, were partly written by OpenAI's Chat-GTP3.

NOTE:
OpenAI API calls are only 'free' for the first three months after generating your OpenAI Account (OpenAI provides a $5 credit that expires).
You can define a hard monthly billing limit (e.g. $1) here.
See their pricing and FAQ here.
Get your OpenAI API key here.

Returns: A string containing the generated text.

Before using gget gpt for the first time, run gget setup gpt / gget.setup("gpt") once (also see gget setup).

Positional argument
prompt
The input prompt to generate text from (str).

api_key
Your OpenAI API key (str) (get your API key).

Optional arguments
-m --model
The name of the GPT model to use for generating the text (str). Default is "gpt-3.5-turbo".
See https://platform.openai.com/docs/models/gpt-4 for more information on the available models.

-temp --temperature
Value between 0 and 2 that controls the level of randomness and creativity in the generated text (float).
Higher values result in more creative and varied text. Default is 1.

-tp --top_p
Controls the diversity of the generated text as an alternative to sampling with temperature (float).
Higher values result in more diverse and unexpected text. Default is 1.
Note: OpenAI recommends altering this or temperature but not both.

-s --stop
A sequence of tokens to mark the end of the generated text (str). Default is None.

-mt --max_tokens
Controls the maximum length of the generated text, in tokens (int). Default is 200.

-pp --presence_penalty
Number between -2.0 and 2.0. Higher values result increase the model's likelihood to talk about new topics (float). Default is 0.

-fp --frequency_penalty
Number between -2.0 and 2.0. Higher values decrease the model's likelihood to repeat the same line verbatim (float). Default is 0.

-lb --logit_bias
A dictionary that specifies a bias towards certain tokens in the generated text (dict). Default is None.

-o --out
If provided, saves the generated text to a file with the specified path (str). Default: Standard out.

Example

gget gpt "How are you today GPT?" your_api_token

# Python
print(gget.gpt("How are you today GPT?", "your_api_token"))

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget info 💡

Fetch extensive gene and transcript metadata from Ensembl, UniProt, and NCBI using Ensembl IDs.
Return format: JSON (command-line) or data frame/CSV (Python).

Positional argument
ens_ids
One or more Ensembl IDs (WormBase and Flybase IDs are also supported).
NOTE: Providing a list of more than 1,000 Ensembl IDs at once might result in a server error (to process more than 1,000 IDs, split the list of IDs into chunks of 1,000 IDs and run these separately).

Optional arguments
-o --out
Path to the file the results will be saved in, e.g. path/to/directory/results.csv (or .json). Default: Standard out.
Python: save=True will save the output in the current working directory.

Flags
-n --ncbi
TURN OFF results from NCBI.
Python: ncbi=False prevents data retrieval from NCBI (default: True).

-u --uniprot
TURN OFF results from UniProt.
Python: uniprot=False prevents data retrieval from UniProt (default: True).

-pdb --pdb
INCLUDE PDB IDs in output (might increase runtime).
Python: pdb=True includes PDB IDs in the results (default: False).

-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

wrap_text
Python only. wrap_text=True displays data frame with wrapped text for easy reading (default: False).

Example

gget info ENSG00000034713 ENSG00000104853 ENSG00000170296

# Python
gget.info(["ENSG00000034713", "ENSG00000104853", "ENSG00000170296"])

→ Returns extensive information about each requested Ensembl ID:

More examples

References

If you use gget info in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Martin FJ, Amode MR, Aneja A, Austine-Orimoloye O, Azov AG, Barnes I, Becker A, Bennett R, Berry A, Bhai J, Bhurji SK, Bignell A, Boddu S, Branco Lins PR, Brooks L, Ramaraju SB, Charkhchi M, Cockburn A, Da Rin Fiorretto L, Davidson C, Dodiya K, Donaldson S, El Houdaigui B, El Naboulsi T, Fatima R, Giron CG, Genez T, Ghattaoraya GS, Martinez JG, Guijarro C, Hardy M, Hollis Z, Hourlier T, Hunt T, Kay M, Kaykala V, Le T, Lemos D, Marques-Coelho D, Marugán JC, Merino GA, Mirabueno LP, Mushtaq A, Hossain SN, Ogeh DN, Sakthivel MP, Parker A, Perry M, Piližota I, Prosovetskaia I, Pérez-Silva JG, Salam AIA, Saraiva-Agostinho N, Schuilenburg H, Sheppard D, Sinha S, Sipos B, Stark W, Steed E, Sukumaran R, Sumathipala D, Suner MM, Surapaneni L, Sutinen K, Szpak M, Tricomi FF, Urbina-Gómez D, Veidenberg A, Walsh TA, Walts B, Wass E, Willhoft N, Allen J, Alvarez-Jarreta J, Chakiachvili M, Flint B, Giorgetti S, Haggerty L, Ilsley GR, Loveland JE, Moore B, Mudge JM, Tate J, Thybert D, Trevanion SJ, Winterbottom A, Frankish A, Hunt SE, Ruffier M, Cunningham F, Dyer S, Finn RD, Howe KL, Harrison PW, Yates AD, Flicek P. Ensembl 2023. Nucleic Acids Res. 2023 Jan 6;51(D1):D933-D941. doi: 10.1093/nar/gkac958. PMID: 36318249; PMCID: PMC9825606.

• Sayers EW, Beck J, Bolton EE, Brister JR, Chan J, Comeau DC, Connor R, DiCuccio M, Farrell CM, Feldgarden M, Fine AM, Funk K, Hatcher E, Hoeppner M, Kane M, Kannan S, Katz KS, Kelly C, Klimke W, Kim S, Kimchi A, Landrum M, Lathrop S, Lu Z, Malheiro A, Marchler-Bauer A, Murphy TD, Phan L, Prasad AB, Pujar S, Sawyer A, Schmieder E, Schneider VA, Schoch CL, Sharma S, Thibaud-Nissen F, Trawick BW, Venkatapathi T, Wang J, Pruitt KD, Sherry ST. Database resources of the National Center for Biotechnology Information. Nucleic Acids Res. 2024 Jan 5;52(D1):D33-D43. doi: 10.1093/nar/gkad1044. PMID: 37994677; PMCID: PMC10767890.

• The UniProt Consortium , UniProt: the Universal Protein Knowledgebase in 2023, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D523–D531, https://doi.org/10.1093/nar/gkac1052

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget muscle 🦾

Align multiple nucleotide or amino acid sequences to each other using Muscle5.
Return format: ClustalW formatted standard out or aligned FASTA (.afa).

Positional argument
fasta
List of sequences or path to FASTA or .txt file containing the nucleotide or amino acid sequences to be aligned.

Optional arguments
-o --out
Path to the aligned FASTA file the results will be saved in, e.g. path/to/directory/results.afa. Default: Standard out.
Python: save=True will save the output in the current working directory.

Flags
-s5 --super5
Aligns input using the Super5 algorithm instead of the Parallel Perturbed Probcons (PPP) algorithm to decrease time and memory.
Use for large inputs (a few hundred sequences).

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Example

gget muscle MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS

# Python
gget.muscle(["MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", "MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS"])

gget muscle fasta.fa

# Python
gget.muscle("fasta.fa")

→ Returns an overview of the aligned sequences with ClustalW coloring. (To return an aligned FASTA (.afa) file, use --out argument (or save=True in Jupyter Lab/Google Colab).) In the above example, the 'fasta.fa' includes several sequences to be aligned (e.g. isoforms returned from gget seq).

You can also view aligned fasta files returned by gget.muscle using programs like alv, as shown below:

# Python
!pip install biopython
!pip install alv
from Bio import AlignIO
import alv

gget.muscle("fasta.fa", out="fasta_aligned.afa")
msa = AlignIO.read("fasta_aligned.afa", "fasta")
alv.view(msa)

More examples

References

If you use gget muscle in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Edgar RC (2021), MUSCLE v5 enables improved estimates of phylogenetic tree confidence by ensemble bootstrapping, bioRxiv 2021.06.20.449169. https://doi.org/10.1101/2021.06.20.449169

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget mutate 🧟

Takes in nucleotide sequences and mutations (in standard mutation annotation and returns mutated versions of the input sequences according to the provided mutations.
Return format: Saves mutated sequences in FASTA format (or returns a list containing the mutated sequences if out=None).

This module was written by Joseph Rich.

Positional argument
sequences
Path to the FASTA file containing the sequences to be mutated, e.g., 'path/to/seqs.fa'.
Sequence identifiers following the '>' character must correspond to the identifiers in the seq_ID column of mutations.

Example format of the FASTA file:

>seq1 (or ENSG00000106443)  
ACTGCGATAGACT  
>seq2  
AGATCGCTAG

Alternatively: Input sequence(s) as a string or list, e.g. 'AGCTAGCT'.

NOTE: Only the letters until the first space or dot will be used as sequence identifiers - Version numbers of Ensembl IDs will be ignored.
NOTE: When the sequences input is a genome fasta file, also see the gtf argument below.

Required arguments
-m --mutations
Path to the csv or tsv file (e.g., 'path/to/mutations.csv') or data frame (DataFrame object) containing information about the mutations in the following format (the 'notes' and 'mut_ID' columns are optional):

'mutation' = Column containing the mutations to be performed written in standard mutation annotation
'mut_ID' = Column containing the identifier for each mutation
'seq_ID' = Column containing the identifiers of the sequences to be mutated (must correspond to the string following the '>' character in the 'sequences' FASTA file; do NOT include spaces or dots)

Alternatively: Input mutation(s) as a string or list, e.g., 'c.2C>T'.
If a list is provided, the number of mutations must equal the number of input sequences.

For use from the terminal (bash): Enclose individual mutation annotations in quotation marks to prevent parsing errors.

Optional input-related arguments
-mc --mut_column
Name of the column containing the mutations to be performed in mutations. Default: 'mutation'.

-sic --seq_id_column
Name of the column containing the IDs of the sequences to be mutated in mutations. Default: 'seq_ID'.

-mic --mut_id_column
Name of the column containing the IDs of each mutation in mutations. Default: Same as mut_column.

-gtf --gtf
Path to a .gtf file. When providing a genome fasta file as input for 'sequences', you can provide a .gtf file here and the input sequences will be defined according to the transcript boundaries, e.g. 'path/to/genome_annotation.gtf'. Default: None

-gtic --gtf_transcript_id_column
Column name in the input mutations file containing the transcript ID. In this case, column seq_id_column should contain the chromosome number.
Required when gtf is provided. Default: None

Optional mutant sequence generation/filtering arguments
-k --k
Length of sequences flanking the mutation. Default: 30.
If k > total length of the sequence, the entire sequence will be kept.

-msl --min_seq_len
Minimum length of the mutant output sequence, e.g. 100. Mutant sequences smaller than this will be dropped. Default: None

-ma --max_ambiguous
Maximum number of 'N' (or 'n') characters allowed in the output sequence, e.g. 10. Default: None (no ambiguous character filter will be applied)

Optional mutant sequence generation/filtering flags
-ofr --optimize_flanking_regions
Removes nucleotides from either end of the mutant sequence to ensure (when possible) that the mutant sequence does not contain any k-mers also found in the wildtype/input sequence.

-rswk --remove_seqs_with_wt_kmers
Removes output sequences where at least one k-mer is also present in the wildtype/input sequence in the same region.
When used with --optimize_flanking_regions, only sequences for which a wildtype k-mer is still present after optimization will be removed.

-mio --merge_identical_off
Do not merge identical mutant sequences in the output (by default, identical sequences will be merged by concatenating the sequence headers for all identical sequences).

Optional arguments to generate additional output
This output is activated using the --update_df flag and will be stored in a copy of the mutations DataFrame.

-udf_o --update_df_out
Path to output csv file containing the updated DataFrame, e.g. 'path/to/mutations_updated.csv'. Only valid when used with --update_df.
Default: None -> the new csv file will be saved in the same directory as the mutations DataFrame with appendix '_updated'

-ts --translate_start
(int or str) The position in the input nucleotide sequence to start translating, e.g. 5. If a string is provided, it should correspond to a column name in mutations containing the open reading frame start positions for each sequence/mutation. Only valid when used with --translate.
Default: translates from the beginning of each sequence

-te --translate_end
(int or str) The position in the input nucleotide sequence to end translating, e.g. 35. If a string is provided, it should correspond to a column name in mutations containing the open reading frame end positions for each sequence/mutation. Only valid when used with --translate.
Default: translates until the end of each sequence

Optional flags to modify additional output
-udf --update_df
Updates the input mutations DataFrame to include additional columns with the mutation type, wildtype nucleotide sequence, and mutant nucleotide sequence (only valid if mutations is a .csv or .tsv file).

-sfs --store_full_sequences
Includes the complete wildtype and mutant sequences in the updated mutations DataFrame (not just the sub-sequence with k-length flanks). Only valid when used with --update_df.

-tr --translate
Adds additional columns to the updated mutations DataFrame containing the wildtype and mutant amino acid sequences. Only valid when used with --store_full_sequences.

Optional general arguments
-o --out
Path to output FASTA file containing the mutated sequences, e.g., 'path/to/output_fasta.fa'.
Default: None -> returns a list of the mutated sequences to standard out.
The identifiers (following the '>') of the mutated sequences in the output FASTA will be '>[seq_ID]_[mut_ID]'.

Optional general flags
-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Examples

gget mutate ATCGCTAAGCT -m 'c.4G>T'

# Python
gget.mutate("ATCGCTAAGCT", "c.4G>T")

→ Returns ATCTCTAAGCT.

List of sequences with a mutation for each sequence provided in a list:

gget mutate ATCGCTAAGCT TAGCTA -m 'c.4G>T' 'c.1_3inv' -o mut_fasta.fa

# Python
gget.mutate(["ATCGCTAAGCT", "TAGCTA"], ["c.4G>T", "c.1_3inv"], out="mut_fasta.fa")

→ Saves 'mut_fasta.fa' file containing:

>seq1_mut1  
ATCTCTAAGCT  
>seq2_mut2  
GATCTA

One mutation applied to several sequences with adjusted k:

gget mutate ATCGCTAAGCT TAGCTA -m 'c.1_3inv' -k 3

# Python
gget.mutate(["ATCGCTAAGCT", "TAGCTA"], "c.1_3inv", k=3)

→ Returns ['CTAGCT', 'GATCTA'].

Add mutations to an entire genome with extended output
Main input:

• mutation information as a mutations CSV (by having seq_id_column contain chromosome information, and mut_column contain mutation information with respect to genome coordinates)
• the genome as the sequences file

Since we are passing the path to a gtf file to the gtf argument, transcript boundaries will be respected (the genome will be split into transcripts). gtf_transcript_id_column specifies the name of the column in mutations containing the transcript IDs corresponding to the transcript IDs in the gtf file.

The optimize_flanking_regions argument maximizes the length of the resulting mutation-containing sequences while maintaining specificity (no wildtype k-mer will be retained).

update_df activates the creation of a new CSV file with updated information about each input and output sequence. This new CSV file will be saved as update_df_out. Since store_full_sequences is activated, this new CSV file will not only contain the output sequences (restricted in size by flanking regiong of size k), but also the complete input and output sequences. This allows us to observe the mutation in the context of the entire sequence. Lastly, we are also adding the translated versions of the complete sequences by adding the with the translate flag, so we can observe how the resulting amino acid sequence is changed. The translate_start and translate_end arguments specify the names of the columns in mutations that contain the start and end positions of the open reading frame (start and end positions for translating the nucleotide sequence to an amino acid sequence), respectively.

gget mutate \
  -m mutations_input.csv \
  -o mut_fasta.fa \
  -k 4 \
  -sic Chromosome \
  -mic Mutation \
  -gtf genome_annotation.gtf \
  -gtic Ensembl_Transcript_ID \
  -ofr \
  -update_df \
  -udf_o mutations_updated.csv \
  -sfs \
  -tr \
  -ts Translate_Start \
  -te Translate_End \
  genome_reference.fa

# Python
gget.mutate(
  sequences="genome_reference.fa",
  mutations="mutations_input.csv",
  out="mut_fasta.fa",
  k=4,
  seq_id_column="Chromosome",
  mut_column="Mutation",
  gtf="genome_annotation.gtf",
  gtf_transcript_id_column="Ensembl_Transcript_ID",
  optimize_flanking_regions=True,
  update_df=True,
  update_df_out="mutations_updated.csv",
  store_full_sequences=True,
  translate=True,
  translate_start="Translate_Start",
  translate_end="Translate_End"
)

→ Takes in a genome fasta ('genome_reference.fa') and gtf file ('genome_annotation.gtf') (these can be downloaded using gget ref) as well as a 'mutations_input.csv' file containing:

| Chromosome | Mutation          | Ensembl_Transcript_ID  | Translate_Start | Translate_End |
|------------|-------------------|------------------------|-----------------|---------------|
| 1          | g.224411A>C       | ENST00000193812        | 0               | 100           |
| 8          | g.25111del        | ENST00000174411        | 0               | 294           |
| X          | g.1011_1012insAA  | ENST00000421914        | 9               | 1211          |

→ Saves 'mut_fasta.fa' file containing:

>1:g.224411A>C  
TGCTCTGCT  
>8:g.25111del  
GAGTCGAT
>X:g.1011_1012insAA
TTAGAACTT

→ Saves 'mutations_updated.csv' file containing:

| Chromosome | Mutation          | Ensembl_Transcript_ID  | mutation_type | wt_sequence | mutant_sequence | wt_sequence_full  | mutant_sequence_full | wt_sequence_aa_full | mutant_sequence_aa_full |
|------------|-------------------|------------------------|---------------|-------------|-----------------|-------------------|----------------------|---------------------|-------------------------|
| 1          | g.224411A>C       | ENSMUST00000193812     | Substitution  | TGCTATGCT   | TGCTCTGCT       | ...TGCTATGCT...   | ...TGCTCTGCT...      | ...CYA...           | ...CSA...               |
| 8          | g.25111del        | ENST00000174411        | Deletion      | GAGTCCGAT   | GAGTCGAT        | ...GAGTCCGAT...   | ...GAGTCGAT...       | ...ESD...           | ...ES...                |
| X          | g.1011_1012insAA  | ENST00000421914        | Insertion     | TTAGCTT     | TTAGAACTT       | ...TTAGCTT...     | ...TTAGAACTT...      | ...A...             | ...EL...                |

References

If you use gget mutate in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget opentargets 🎯

Fetch associated diseases or drugs from OpenTargets using Ensembl IDs.
Return format: JSON/CSV (command-line) or data frame (Python).

This module was written by Sam Wagenaar.

Positional argument
ens_id
Ensembl gene ID, e.g ENSG00000169194.

Optional arguments
-r --resource
Defines the type of information to return in the output. Default: 'diseases'.
Possible resources are:

-l --limit
Limit the number of results, e.g 10. Default: No limit.
Note: Not compatible with the tractability and depmap resources.

-o --out
Path to the JSON file the results will be saved in, e.g. path/to/directory/results.json. Default: Standard out.
Python: save=True will save the output in the current working directory.

Optional filter arguments

-fd --filter_disease disease_id
Filter by disease ID, e.g. 'EFO_0000274'. Only valid for the drugs resource.

-fc --filter_drug drug_id
Filter by drug ID, e.g. 'CHEMBL1743081'. Only valid for the pharmacogenetics resource.

-ft --filter_tissue tissue_id
Filter by tissue ID, e.g. 'UBERON_0000473'. Only valid for the expression and depmap resources.

-fa --filter_anat_sys
Filter by anatomical system, e.g. 'nervous system'. Only valid for the expression resource.

-fo --filter_organ anatomical_system
Filter by organ, e.g. 'brain'. Only valid for the expression resource.

-fpa --filter_protein_a protein_a_id
Filter by the protein ID of the first protein in the interaction, e.g. 'ENSP00000304915'. Only valid for the interactions resource.

-fpb --filter_protein_b protein_b_id
Filter by the protein ID of the second protein in the interaction, e.g. 'ENSP00000379111'. Only valid for the interactions resource.

-fgb --filter_gene_b gene_b_id
Filter by the gene ID of the second protein in the interaction, e.g. 'ENSG00000077238'. Only valid for the interactions resource.

filters
Python only. A dictionary of filters, e.g.

{'disease_id': ['EFO_0000274', 'HP_0000964']}

filter_mode
Python only. filter_mode='or' combines filters of different IDs with OR logic. filter_mode='and' combines filters of different IDs with AND logic (default).

Flags
-csv --csv
Command-line only. Returns the output in CSV format, instead of JSON format. Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

-or --or
Command-line only. Filters are combined with OR logic. Default: AND logic.

wrap_text
Python only. wrap_text=True displays data frame with wrapped text for easy reading (default: False).

Examples

Get associated diseases for a specific gene:

gget opentargets ENSG00000169194 -r diseases -l 1

# Python
import gget
gget.opentargets('ENSG00000169194', resource='diseases', limit=1)

→ Returns the top disease associated with the gene ENSG00000169194.

Get associated drugs for a specific gene:

gget opentargets ENSG00000169194 -r drugs -l 2

# Python
import gget
gget.opentargets('ENSG00000169194', resource='drugs', limit=2)

→ Returns the top 2 drugs associated with the gene ENSG00000169194.

Note: Returned trial_ids are ClinicalTrials.gov identifiers

Get tractability data for a specific gene:

gget opentargets ENSG00000169194 -r tractability

# Python
import gget
gget.opentargets('ENSG00000169194', resource='tractability')

→ Returns tractability data for the gene ENSG00000169194.

Get pharmacogenetic responses for a specific gene:

gget opentargets ENSG00000169194 -r pharmacogenetics -l 1

# Python
import gget
gget.opentargets('ENSG00000169194', resource='pharmacogenetics', limit=1)

→ Returns pharmacogenetic responses for the gene ENSG00000169194.

Note: Returned literature ids are Europe PMC identifiers

Get tissues where a gene is most expressed:

gget opentargets ENSG00000169194 -r expression -l 2

# Python
import gget
gget.opentargets('ENSG00000169194', resource='expression', limit=2)

→ Returns the top 2 tissues where the gene ENSG00000169194 is most expressed.

Get DepMap gene-disease effect data for a specific gene:

gget opentargets ENSG00000169194 -r depmap

# Python
import gget
gget.opentargets('ENSG00000169194', resource='depmap')

→ Returns DepMap gene-disease effect data for the gene ENSG00000169194.

Get protein-protein interactions for a specific gene:

gget opentargets ENSG00000169194 -r interactions -l 2

# Python
import gget
gget.opentargets('ENSG00000169194', resource='interactions', limit=2)

→ Returns the top 2 protein-protein interactions for the gene ENSG00000169194.

Get protein-protein interactions for a specific gene, filtering by protein and gene IDs:

gget opentargets ENSG00000169194 -r interactions -fpa P35225 --filter_gene_b ENSG00000077238

# Python
import gget
gget.opentargets('ENSG00000169194', resource='interactions', filters={'protein_a_id': 'P35225', 'gene_b_id': 'ENSG00000077238'})

→ Returns protein-protein interactions for the gene ENSG00000169194, where the first protein is P35225 and the second gene is ENSG00000077238.

Get protein-protein interactions for a specific gene, filtering by protein or gene IDs:

gget opentargets ENSG00000169194 -r interactions -fpa P35225 --filter_gene_b ENSG00000077238 ENSG00000111537 --or -l 5

# Python
import gget
gget.opentargets(
    'ENSG00000169194',
    resource='interactions',
    filters={'protein_a_id': 'P35225', 'gene_b_id': ['ENSG00000077238', 'ENSG00000111537']},
    filter_mode='or',
    limit=5
)

→ Returns protein-protein interactions for the gene ENSG00000169194, where the first protein is P35225 or the second gene is either ENSG00000077238 or ENSG00000111537.

More examples

References

If you use gget opentargets in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Ochoa D, Hercules A, Carmona M, Suveges D, Baker J, Malangone C, Lopez I, Miranda A, Cruz-Castillo C, Fumis L, Bernal-Llinares M, Tsukanov K, Cornu H, Tsirigos K, Razuvayevskaya O, Buniello A, Schwartzentruber J, Karim M, Ariano B, Martinez Osorio RE, Ferrer J, Ge X, Machlitt-Northen S, Gonzalez-Uriarte A, Saha S, Tirunagari S, Mehta C, Roldán-Romero JM, Horswell S, Young S, Ghoussaini M, Hulcoop DG, Dunham I, McDonagh EM. The next-generation Open Targets Platform: reimagined, redesigned, rebuilt. Nucleic Acids Res. 2023 Jan 6;51(D1):D1353-D1359. doi: 10.1093/nar/gkac1046. PMID: 36399499; PMCID: PMC9825572.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget pdb 🔮

Query RCSB Protein Data Bank (PDB) for the protein structure/metadata of a given PDB ID.
Return format: Resource 'pdb' is returned in PDB format. All other resources are returned in JSON format.

Positional argument
pdb_id
PDB ID to be queried, e.g. '7S7U'.

Optional arguments
-r --resource
Defines type of information to be returned. One of the following:
'pdb': Returns the protein structure in PDB format (default).
'entry': Information about PDB structures at the top level of PDB structure hierarchical data organization.
'pubmed': Get PubMed annotations (data integrated from PubMed) for a given entry's primary citation.
'assembly': Information about PDB structures at the quaternary structure level.
'branched_entity': Get branched entity description (define entity ID as 'identifier').
'nonpolymer_entity': Get non-polymer entity data (define entity ID as 'identifier').
'polymer_entity': Get polymer entity data (define entity ID as 'identifier').
'uniprot': Get UniProt annotations for a given macromolecular entity (define entity ID as 'identifier').
'branched_entity_instance': Get branched entity instance description (define chain ID as 'identifier').
'polymer_entity_instance': Get polymer entity instance (a.k.a chain) data (define chain ID as 'identifier').
'nonpolymer_entity_instance': Get non-polymer entity instance description (define chain ID as 'identifier').

-i --identifier
Can be used to define assembly, entity or chain ID (default: None). Assembly/entity IDs are numbers (e.g. 1), and chain IDs are letters (e.g. 'A').

-o --out
Path to the file the results will be saved in, e.g. path/to/directory/7S7U.pdb or path/to/directory/7S7U_entry.json. Default: Standard out.
Python: save=True will save the output in the current working directory.

Examples

gget pdb 7S7U -o 7S7U.pdb

# Python
gget.pdb("7S7U", save=True)

→ Saves the structure of 7S7U in PDB format as '7S7U.pdb' in the current working directory.

Find PDB crystal structures for a comparative analysis of protein structure:

# Find PDB IDs associated with an Ensembl ID 
gget info ENSG00000130234

# Alternatively: Since many entries in the PDB do not have linked Ensembl IDs, 
# you will likely find more PDB entries by BLASTing the sequence agains the PDB.

# Get the amino acid sequence of a transcript from an Ensembl ID
gget seq --translate ENSG00000130234 -o gget_seq_results.fa

# BLAST an amino acid sequence to find similar structures in the PDB
gget blast --database pdbaa gget_seq_results.fa

# Get PDB files from the PDB IDs returned by gget blast for comparative analysis
gget pdb 7DQA -o 7DQA.pdb
gget pdb 7CT5 -o 7CT5.pdb

# Find PDB IDs associated with an Ensembl ID 
gget.info("ENSG00000130234")

# Alternatively: Since many entries in the PDB do not have linked Ensembl IDs, 
# you will likely find more PDB entries by BLASTing the sequence agains the PDB.

# Get the amino acid sequence of a transcript from an Ensembl ID
gget.seq("ENSG00000130234", translate=True, save=True)

# BLAST an amino acid sequence to find similar structures in the PDB
gget.blast("gget_seq_results.fa", database="pdbaa")

# Get PDB files from the PDB IDs returned by gget blast for comparative analysis
gget.pdb("7DQA", save=True)
gget.pdb("7CT5", save=True)

→ The use case above exemplifies how to find PDB files for comparative analysis of protein structure starting with Ensembl IDs or amino acid sequences. The fetched PDB files can also be compared to predicted structures generated by gget alphafold. PDB files can be viewed interactively in 3D online, or using programs like PyMOL or Blender. To compare two PDB files, you can use this website.

More examples

References

If you use gget pdb in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE. The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. doi: 10.1093/nar/28.1.235. PMID: 10592235; PMCID: PMC102472.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget ref 📖

Fetch FTPs and their respective metadata (or use flag ftp to only return the links) for reference genomes and annotations from Ensembl by species.
Return format: dictionary/JSON.

Positional argument
species
Species for which the FTPs will be fetched in the format genus_species, e.g. homo_sapiens.
Supports all available vertebrate and invertebrate (plants, fungi, protists, and invertebrate metazoa) genomes from Ensembl, except bacteria.
Note: Not required when using flags --list_species or --list_iv_species.
Supported shortcuts: 'human', 'mouse', 'human_grch37' (accesses the GRCh37 genome assembly)

Optional arguments
-w --which
Defines which results to return. Default: 'all' -> Returns all available results.
Possible entries are one or a combination (as comma-separated list) of the following:
'gtf' - Returns the annotation (GTF).
'cdna' - Returns the trancriptome (cDNA).
'dna' - Returns the genome (DNA).
'cds' - Returns the coding sequences corresponding to Ensembl genes. (Does not contain UTR or intronic sequence.)
'cdrna' - Returns transcript sequences corresponding to non-coding RNA genes (ncRNA).
'pep' - Returns the protein translations of Ensembl genes.

-r --release
Defines the Ensembl release number from which the files are fetched, e.g. 104. Default: latest Ensembl release.

-od --out_dir
Path to the directory where the FTPs will be saved, e.g. path/to/directory/. Default: Current working directory.

-o --out
Path to the JSON file the results will be saved in, e.g. path/to/directory/results.json. Default: Standard out.
Python: save=True will save the output in the current working directory.

Flags
-l --list_species
Lists all available vertebrate species. (Python: combine with species=None.)

-liv --list_iv_species
Lists all available invertebrate species. (Python: combine with species=None.)

-ftp --ftp
Returns only the requested FTP links.

-d --download
Command-line only. Downloads the requested FTPs to the directory specified by out_dir (requires curl to be installed).

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Examples

Get the genome reference for a specific species:

gget ref -w gtf,dna homo_sapiens

# Python
gget.ref("homo_sapiens", which=["gtf", "dna"])

→ Returns a JSON with the latest human GTF and FASTA FTPs, and their respective metadata, in the format:

{
    "homo_sapiens": {
        "annotation_gtf": {
            "ftp": "http://ftp.ensembl.org/pub/release-106/gtf/homo_sapiens/Homo_sapiens.GRCh38.106.gtf.gz",
            "ensembl_release": 106,
            "release_date": "28-Feb-2022",
            "release_time": "23:27",
            "bytes": "51379459"
        },
        "genome_dna": {
            "ftp": "http://ftp.ensembl.org/pub/release-106/fasta/homo_sapiens/dna/Homo_sapiens.GRCh38.dna.primary_assembly.fa.gz",
            "ensembl_release": 106,
            "release_date": "21-Feb-2022",
            "release_time": "09:35",
            "bytes": "881211416"
        }
    }
}

List all available genomes from Ensembl release 103:

gget ref --list_species -r 103

# Python
gget.ref(species=None, list_species=True, release=103)

→ Returns a list with all available genomes (checks if GTF and FASTAs are available) from Ensembl release 103.
(If no release is specified, gget ref will always return information from the latest Ensembl release.)

Use gget ref in combination with kallisto | bustools to build a reference index:

kb ref \
    -i index.idx \
    -g t2g.txt \
    -f1 fasta.fa \
    $(gget ref --ftp -w dna,gtf homo_sapiens)

→ kb ref builds a reference index using the latest DNA and GTF files of species Homo sapiens passed to it by gget ref.

More examples

References

If you use gget ref in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Martin FJ, Amode MR, Aneja A, Austine-Orimoloye O, Azov AG, Barnes I, Becker A, Bennett R, Berry A, Bhai J, Bhurji SK, Bignell A, Boddu S, Branco Lins PR, Brooks L, Ramaraju SB, Charkhchi M, Cockburn A, Da Rin Fiorretto L, Davidson C, Dodiya K, Donaldson S, El Houdaigui B, El Naboulsi T, Fatima R, Giron CG, Genez T, Ghattaoraya GS, Martinez JG, Guijarro C, Hardy M, Hollis Z, Hourlier T, Hunt T, Kay M, Kaykala V, Le T, Lemos D, Marques-Coelho D, Marugán JC, Merino GA, Mirabueno LP, Mushtaq A, Hossain SN, Ogeh DN, Sakthivel MP, Parker A, Perry M, Piližota I, Prosovetskaia I, Pérez-Silva JG, Salam AIA, Saraiva-Agostinho N, Schuilenburg H, Sheppard D, Sinha S, Sipos B, Stark W, Steed E, Sukumaran R, Sumathipala D, Suner MM, Surapaneni L, Sutinen K, Szpak M, Tricomi FF, Urbina-Gómez D, Veidenberg A, Walsh TA, Walts B, Wass E, Willhoft N, Allen J, Alvarez-Jarreta J, Chakiachvili M, Flint B, Giorgetti S, Haggerty L, Ilsley GR, Loveland JE, Moore B, Mudge JM, Tate J, Thybert D, Trevanion SJ, Winterbottom A, Frankish A, Hunt SE, Ruffier M, Cunningham F, Dyer S, Finn RD, Howe KL, Harrison PW, Yates AD, Flicek P. Ensembl 2023. Nucleic Acids Res. 2023 Jan 6;51(D1):D933-D941. doi: 10.1093/nar/gkac958. PMID: 36318249; PMCID: PMC9825606.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget search 🔎

Fetch genes and transcripts from Ensembl using free-form search terms.
Results are matched based on the "gene name" and "description" sections in the Ensembl database. gget version >= 0.27.9 also includes results that match the Ensembl "synonym" section.
Return format: JSON (command-line) or data frame/CSV (Python).

Positional argument
searchwords
One or more free form search words, e.g. gaba nmda. (Note: Search is not case-sensitive.)

Other required arguments
-s --species
Species or database to be searched.
A species can be passed in the format 'genus_species', e.g. 'homo_sapiens' or 'arabidopsis_thaliana'.
To pass a specific database, pass the name of the CORE database, e.g. 'mus_musculus_dba2j_core_105_1'.

All available core databases can be found here:
Vertebrates: http://ftp.ensembl.org/pub/current/mysql/
Invertebrates: http://ftp.ensemblgenomes.org/pub/current/ + select kingdom + go to mysql/

Supported shortcuts: 'human', 'mouse'

Optional arguments
-r --release
Defines the Ensembl release number from which the files are fetched, e.g. 104. Default: None -> latest Ensembl release is used.

Note: The release argument does not apply to invertebrate species (you can pass a specific core database (which includes a release number) to the species argument instead). For invertebrate species, Ensembl only stores databases from 10 releases prior to the current release.

This argument is overwritten if a specific database (which includes a release number) is passed to the species argument.

-t --id_type
'gene' (default) or 'transcript'
Returns genes or transcripts, respectively.

-ao --andor
'or' (default) or 'and'
'or': Returns all genes that INCLUDE AT LEAST ONE of the searchwords in their name/description.
'and': Returns only genes that INCLUDE ALL of the searchwords in their name/description.

-l --limit
Limits the number of search results, e.g. 10. Default: None.

-o --out
Path to the csv the results will be saved in, e.g. path/to/directory/results.csv (or .json). Default: Standard out.
Python: save=True will save the output in the current working directory.

Flags
-csv --csv
Command-line only. Returns results in CSV format.
Python: Use json=True to return output in JSON format.

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

wrap_text
Python only. wrap_text=True displays data frame with wrapped text for easy reading (default: False).

Example

gget search -s human gaba gamma-aminobutyric

# Python
gget.search(["gaba", "gamma-aminobutyric"], "homo_sapiens")

→ Returns all genes that contain at least one of the search words in their name or Ensembl/external reference description:

More examples

References

If you use gget search in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Martin FJ, Amode MR, Aneja A, Austine-Orimoloye O, Azov AG, Barnes I, Becker A, Bennett R, Berry A, Bhai J, Bhurji SK, Bignell A, Boddu S, Branco Lins PR, Brooks L, Ramaraju SB, Charkhchi M, Cockburn A, Da Rin Fiorretto L, Davidson C, Dodiya K, Donaldson S, El Houdaigui B, El Naboulsi T, Fatima R, Giron CG, Genez T, Ghattaoraya GS, Martinez JG, Guijarro C, Hardy M, Hollis Z, Hourlier T, Hunt T, Kay M, Kaykala V, Le T, Lemos D, Marques-Coelho D, Marugán JC, Merino GA, Mirabueno LP, Mushtaq A, Hossain SN, Ogeh DN, Sakthivel MP, Parker A, Perry M, Piližota I, Prosovetskaia I, Pérez-Silva JG, Salam AIA, Saraiva-Agostinho N, Schuilenburg H, Sheppard D, Sinha S, Sipos B, Stark W, Steed E, Sukumaran R, Sumathipala D, Suner MM, Surapaneni L, Sutinen K, Szpak M, Tricomi FF, Urbina-Gómez D, Veidenberg A, Walsh TA, Walts B, Wass E, Willhoft N, Allen J, Alvarez-Jarreta J, Chakiachvili M, Flint B, Giorgetti S, Haggerty L, Ilsley GR, Loveland JE, Moore B, Mudge JM, Tate J, Thybert D, Trevanion SJ, Winterbottom A, Frankish A, Hunt SE, Ruffier M, Cunningham F, Dyer S, Finn RD, Howe KL, Harrison PW, Yates AD, Flicek P. Ensembl 2023. Nucleic Acids Res. 2023 Jan 6;51(D1):D933-D941. doi: 10.1093/nar/gkac958. PMID: 36318249; PMCID: PMC9825606.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget setup 🔧

Function to install/download third-party dependencies for a specified gget module.

Positional argument
module
gget module for which dependencies should be installed.

Optional arguments
-o --out
Path to the folder downloaded files will be saved in (currently only applies to module = 'elm').
NOTE: Do NOT use this argument when downloading the files for use with gget.elm.
Default: None (downloaded files are saved inside the gget package installation folder).

Flags
-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Example

gget setup alphafold

# Python
gget.setup("alphafold")

→ Installs all (modified) third-party dependencies and downloads model parameters (~4GB) required to run gget alphafold.

Python arguments are equivalent to long-option arguments (--arg), unless otherwise specified. Flags are True/False arguments in Python. The manual for any gget tool can be called from the command-line using the -h --help flag.

gget seq 🧬

Fetch nucleotide or amino acid sequence(s) of a gene (and all its isoforms) or a transcript by Ensembl ID.
Return format: FASTA.

Positional argument
ens_ids
One or more Ensembl IDs.

Optional arguments
-o --out
Path to the file the results will be saved in, e.g. path/to/directory/results.fa. Default: Standard out.
Python: save=True will save the output in the current working directory.

Flags
-t --translate
Returns amino acid (instead of nucleotide) sequences.
Nucleotide sequences are fetched from Ensembl.
Amino acid sequences are fetched from UniProt.

-iso --isoforms
Returns the sequences of all known transcripts.
(Only for gene IDs.)

-q --quiet
Command-line only. Prevents progress information from being displayed.
Python: Use verbose=False to prevent progress information from being displayed.

Examples

gget seq ENSG00000034713 ENSG00000104853 ENSG00000170296

# Python
gget.seq(["ENSG00000034713", "ENSG00000104853", "ENSG00000170296"])

→ Returns the nucleotide sequences of ENSG00000034713, ENSG00000104853, and ENSG00000170296 in FASTA format.

gget seq -t -iso ENSG00000034713

# Python
gget.seq("ENSG00000034713", translate=True, isoforms=True)

→ Returns the amino acid sequences of all known transcripts of ENSG00000034713 in FASTA format.

More examples

References

If you use gget seq in a publication, please cite the following articles:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Martin FJ, Amode MR, Aneja A, Austine-Orimoloye O, Azov AG, Barnes I, Becker A, Bennett R, Berry A, Bhai J, Bhurji SK, Bignell A, Boddu S, Branco Lins PR, Brooks L, Ramaraju SB, Charkhchi M, Cockburn A, Da Rin Fiorretto L, Davidson C, Dodiya K, Donaldson S, El Houdaigui B, El Naboulsi T, Fatima R, Giron CG, Genez T, Ghattaoraya GS, Martinez JG, Guijarro C, Hardy M, Hollis Z, Hourlier T, Hunt T, Kay M, Kaykala V, Le T, Lemos D, Marques-Coelho D, Marugán JC, Merino GA, Mirabueno LP, Mushtaq A, Hossain SN, Ogeh DN, Sakthivel MP, Parker A, Perry M, Piližota I, Prosovetskaia I, Pérez-Silva JG, Salam AIA, Saraiva-Agostinho N, Schuilenburg H, Sheppard D, Sinha S, Sipos B, Stark W, Steed E, Sukumaran R, Sumathipala D, Suner MM, Surapaneni L, Sutinen K, Szpak M, Tricomi FF, Urbina-Gómez D, Veidenberg A, Walsh TA, Walts B, Wass E, Willhoft N, Allen J, Alvarez-Jarreta J, Chakiachvili M, Flint B, Giorgetti S, Haggerty L, Ilsley GR, Loveland JE, Moore B, Mudge JM, Tate J, Thybert D, Trevanion SJ, Winterbottom A, Frankish A, Hunt SE, Ruffier M, Cunningham F, Dyer S, Finn RD, Howe KL, Harrison PW, Yates AD, Flicek P. Ensembl 2023. Nucleic Acids Res. 2023 Jan 6;51(D1):D933-D941. doi: 10.1093/nar/gkac958. PMID: 36318249; PMCID: PMC9825606

• The UniProt Consortium , UniProt: the Universal Protein Knowledgebase in 2023, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D523–D531, https://doi.org/10.1093/nar/gkac1052

Welcome to gget's contributing guide

Thank you for investing your time in contributing to our project! Any contribution you make will be reflected on the gget repo. ✨

Read our Code of Conduct to keep our community approachable and respectable.

In this guide you will get an overview of the contribution workflow from opening an issue or creating a pull request (PR) to reviewing and merging a PR.

Issues

Create a new issue

If you spot a problem with gget or you have an idea for a new feature, check if an issue already exists. If a related issue doesn't exist, you can open a new issue using the relevant issue form.

Solve an issue

Scan through our existing issues to find one that interests you. You can narrow down the search using labels as filters. If you find an issue to work on, you are welcome to open a PR with a fix.

Contribute through pull requests

Getting started

1. Fork the repository.

• Using GitHub Desktop:

  • Getting started with GitHub Desktop will guide you through setting up Desktop.
  • Once Desktop is set up, you can use it to fork the repo!

• Using the command line:

  • Fork the repo so that you can make your changes without affecting the original project until you're ready to merge them.

2. Create a working branch and start with your changes!

Commit your update

Commit the changes once you are happy with them.

‼️ Self-review the following before creating a Pull Request ‼️

1. Review the content for technical accuracy.
2. Copy-edit the changes/comments for grammar, spelling, and adherence to the general style of existing gget code.
3. Format your code using black.
4. Make sure the unit tests pass:
   • Developer dependencies can be installed with pip install -r dev-requirements.txt
   • Run existing unit tests from the gget repository root with coverage run -m pytest -ra -v tests && coverage report --omit=main.py,tests*
5. Add new unit tests if applicable:
   • Arguments and expected results are stored in json files in ./tests/fixtures/
   • Unit tests can be added to ./tests/test_*.py and will be automatically detected
6. Make sure the edits are compatible with both the Python and the command line interface
   • The command line interface and arguments are defined in ./gget/main.py
7. Add new modules/arguments to the documentation if applicable:
   • The manual for each module can be edited/added as ./docs/src/*.md

If you have any questions, feel free to start a discussion or create an issue as described above.

Pull Request

When you're finished with the changes, create a pull request, also known as a PR.

‼️ Please make all PRs against the dev branch of the gget repository.

• Don't forget to link PR to issue if you are solving one.
• Enable the checkbox to allow maintainer edits so the branch can be updated for a merge.
• If you run into any merge issues, checkout this git tutorial to help you resolve merge conflicts and other issues.

Once you submit your PR, a gget team member will review your proposal. We may ask questions or request additional information.

Your PR is merged!

Congratulations! 🎉 The gget team thanks you. ✨

Once your PR is merged, your contributions will be publicly visible on the gget repo.

Contributor Covenant Code of Conduct

Our Pledge

We as members, contributors, and leaders pledge to make participation in our community a harassment-free experience for everyone, regardless of age, body size, visible or invisible disability, ethnicity, sex characteristics, gender identity and expression, level of experience, education, socio-economic status, nationality, personal appearance, race, religion, or sexual identity and orientation.

We pledge to act and interact in ways that contribute to an open, welcoming, diverse, inclusive, and healthy community.

Our Standards

Examples of behavior that contributes to a positive environment for our community include:

• Demonstrating empathy and kindness toward other people
• Being respectful of differing opinions, viewpoints, and experiences
• Giving and gracefully accepting constructive feedback
• Accepting responsibility and apologizing to those affected by our mistakes, and learning from the experience
• Focusing on what is best not just for us as individuals, but for the overall community

Examples of unacceptable behavior include:

• The use of sexualized language or imagery, and sexual attention or advances of any kind
• Trolling, insulting or derogatory comments, and personal or political attacks
• Public or private harassment
• Publishing others' private information, such as a physical or email address, without their explicit permission
• Other conduct which could reasonably be considered inappropriate in a professional setting

Enforcement Responsibilities

Community leaders are responsible for clarifying and enforcing our standards of acceptable behavior and will take appropriate and fair corrective action in response to any behavior that they deem inappropriate, threatening, offensive, or harmful.

Community leaders have the right and responsibility to remove, edit, or reject comments, commits, code, wiki edits, issues, and other contributions that are not aligned to this Code of Conduct, and will communicate reasons for moderation decisions when appropriate.

Scope

This Code of Conduct applies within all community spaces, and also applies when an individual is officially representing the community in public spaces. Examples of representing our community include using an official e-mail address, posting via an official social media account, or acting as an appointed representative at an online or offline event.

Enforcement

Instances of abusive, harassing, or otherwise unacceptable behavior may be reported to the community leaders responsible for enforcement at lpachter@caltech.edu. All complaints will be reviewed and investigated promptly and fairly.

All community leaders are obligated to respect the privacy and security of the reporter of any incident.

Enforcement Guidelines

Community leaders will follow these Community Impact Guidelines in determining the consequences for any action they deem in violation of this Code of Conduct:

1. Correction

Community Impact: Use of inappropriate language or other behavior deemed unprofessional or unwelcome in the community.

Consequence: A private, written warning from community leaders, providing clarity around the nature of the violation and an explanation of why the behavior was inappropriate. A public apology may be requested.

2. Warning

Community Impact: A violation through a single incident or series of actions.

Consequence: A warning with consequences for continued behavior. No interaction with the people involved, including unsolicited interaction with those enforcing the Code of Conduct, for a specified period of time. This includes avoiding interactions in community spaces as well as external channels like social media. Violating these terms may lead to a temporary or permanent ban.

3. Temporary Ban

Community Impact: A serious violation of community standards, including sustained inappropriate behavior.

Consequence: A temporary ban from any sort of interaction or public communication with the community for a specified period of time. No public or private interaction with the people involved, including unsolicited interaction with those enforcing the Code of Conduct, is allowed during this period. Violating these terms may lead to a permanent ban.

4. Permanent Ban

Community Impact: Demonstrating a pattern of violation of community standards, including sustained inappropriate behavior, harassment of an individual, or aggression toward or disparagement of classes of individuals.

Consequence: A permanent ban from any sort of public interaction within the community.

Attribution

This Code of Conduct is adapted from the Contributor Covenant, version 2.0, available at https://www.contributor-covenant.org/version/2/0/code_of_conduct.html.

Community Impact Guidelines were inspired by Mozilla's code of conduct enforcement ladder.

For answers to common questions about this code of conduct, see the FAQ at https://www.contributor-covenant.org/faq. Translations are available at https://www.contributor-covenant.org/translations.

Citation

If you use gget in a publication, please cite:
Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• If using gget alphafold, please also cite:

  • Jumper, J., Evans, R., Pritzel, A. et al. Highly accurate protein structure prediction with AlphaFold. Nature 596, 583–589 (2021). https://doi.org/10.1038/s41586-021-03819-2

  And, if applicable:

  • Evans, R. et al. Protein complex prediction with AlphaFold-Multimer. bioRxiv 2021.10.04.463034; https://doi.org/10.1101/2021.10.04.463034

• If using gget archs4, please also cite:

  • Lachmann A, Torre D, Keenan AB, Jagodnik KM, Lee HJ, Wang L, Silverstein MC, Ma’ayan A. Massive mining of publicly available RNA-seq data from human and mouse. Nature Communications 9. Article number: 1366 (2018), doi:10.1038/s41467-018-03751-6

  • Bray NL, Pimentel H, Melsted P and Pachter L, Near optimal probabilistic RNA-seq quantification, Nature Biotechnology 34, p 525--527 (2016). https://doi.org/10.1038/nbt.3519

• If using gget bgee, please also cite:

  • Frederic B Bastian, Julien Roux, Anne Niknejad, Aurélie Comte, Sara S Fonseca Costa, Tarcisio Mendes de Farias, Sébastien Moretti, Gilles Parmentier, Valentine Rech de Laval, Marta Rosikiewicz, Julien Wollbrett, Amina Echchiki, Angélique Escoriza, Walid H Gharib, Mar Gonzales-Porta, Yohan Jarosz, Balazs Laurenczy, Philippe Moret, Emilie Person, Patrick Roelli, Komal Sanjeev, Mathieu Seppey, Marc Robinson-Rechavi (2021). The Bgee suite: integrated curated expression atlas and comparative transcriptomics in animals. Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D831–D847, https://doi.org/10.1093/nar/gkaa793

• If using gget blast, please also cite:

  • Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ. Basic local alignment search tool. J Mol Biol. 1990 Oct 5;215(3):403-10. doi: 10.1016/S0022-2836(05)80360-2. PMID: 2231712.

• If using gget blat, please also cite:

  • Kent WJ. BLAT--the BLAST-like alignment tool. Genome Res. 2002 Apr;12(4):656-64. doi: 10.1101/gr.229202. PMID: 11932250; PMCID: PMC187518.

• If using gget cbio, please also cite:

  • Cerami E, Gao J, Dogrusoz U, Gross BE, Sumer SO, Aksoy BA, Jacobsen A, Byrne CJ, Heuer ML, Larsson E, Antipin Y, Reva B, Goldberg AP, Sander C, Schultz N. The cBio cancer genomics portal: an open platform for exploring multidimensional cancer genomics data. Cancer Discov. 2012 May;2(5):401-4. doi: 10.1158/2159-8290.CD-12-0095. Erratum in: Cancer Discov. 2012 Oct;2(10):960. PMID: 22588877; PMCID: PMC3956037.

  • Gao J, Aksoy BA, Dogrusoz U, Dresdner G, Gross B, Sumer SO, Sun Y, Jacobsen A, Sinha R, Larsson E, Cerami E, Sander C, Schultz N. Integrative analysis of complex cancer genomics and clinical profiles using the cBioPortal. Sci Signal. 2013 Apr 2;6(269):pl1. doi: 10.1126/scisignal.2004088. PMID: 23550210; PMCID: PMC4160307.

  • de Bruijn I, Kundra R, Mastrogiacomo B, Tran TN, Sikina L, Mazor T, Li X, Ochoa A, Zhao G, Lai B, Abeshouse A, Baiceanu D, Ciftci E, Dogrusoz U, Dufilie A, Erkoc Z, Garcia Lara E, Fu Z, Gross B, Haynes C, Heath A, Higgins D, Jagannathan P, Kalletla K, Kumari P, Lindsay J, Lisman A, Leenknegt B, Lukasse P, Madela D, Madupuri R, van Nierop P, Plantalech O, Quach J, Resnick AC, Rodenburg SYA, Satravada BA, Schaeffer F, Sheridan R, Singh J, Sirohi R, Sumer SO, van Hagen S, Wang A, Wilson M, Zhang H, Zhu K, Rusk N, Brown S, Lavery JA, Panageas KS, Rudolph JE, LeNoue-Newton ML, Warner JL, Guo X, Hunter-Zinck H, Yu TV, Pilai S, Nichols C, Gardos SM, Philip J; AACR Project GENIE BPC Core Team, AACR Project GENIE Consortium; Kehl KL, Riely GJ, Schrag D, Lee J, Fiandalo MV, Sweeney SM, Pugh TJ, Sander C, Cerami E, Gao J, Schultz N. Analysis and Visualization of Longitudinal Genomic and Clinical Data from the AACR Project GENIE Biopharma Collaborative in cBioPortal. Cancer Res. 2023 Dec 1;83(23):3861-3867. doi: 10.1158/0008-5472.CAN-23-0816. PMID: 37668528; PMCID: PMC10690089.

  • Please also cite the source of the data if you are using a publicly available dataset.

• If using gget cellxgene, please also cite:

  • Chanzuckerberg Initiative. (n.d.). CZ CELLxGENE Discover. Retrieved [insert date here], from https://cellxgene.cziscience.com/

• If using gget cosmic, please also cite:

  • Tate JG, Bamford S, Jubb HC, Sondka Z, Beare DM, Bindal N, Boutselakis H, Cole CG, Creatore C, Dawson E, Fish P, Harsha B, Hathaway C, Jupe SC, Kok CY, Noble K, Ponting L, Ramshaw CC, Rye CE, Speedy HE, Stefancsik R, Thompson SL, Wang S, Ward S, Campbell PJ, Forbes SA. COSMIC: the Catalogue Of Somatic Mutations In Cancer. Nucleic Acids Res. 2019 Jan 8;47(D1):D941-D947. doi: 10.1093/nar/gky1015. PMID: 30371878; PMCID: PMC6323903.

• If using gget diamond, please also cite:

  • Buchfink, B., Xie, C. & Huson, D. Fast and sensitive protein alignment using DIAMOND. Nat Methods 12, 59–60 (2015). https://doi.org/10.1038/nmeth.3176

• If using gget elm, please also cite:

  • Laura Luebbert, Chi Hoang, Manjeet Kumar, Lior Pachter, Fast and scalable querying of eukaryotic linear motifs with gget elm, Bioinformatics, 2024, btae095, https://doi.org/10.1093/bioinformatics/btae095

  • Manjeet Kumar, Sushama Michael, Jesús Alvarado-Valverde, Bálint Mészáros, Hugo Sámano‐Sánchez, András Zeke, Laszlo Dobson, Tamas Lazar, Mihkel Örd, Anurag Nagpal, Nazanin Farahi, Melanie Käser, Ramya Kraleti, Norman E Davey, Rita Pancsa, Lucía B Chemes, Toby J Gibson, The Eukaryotic Linear Motif resource: 2022 release, Nucleic Acids Research, Volume 50, Issue D1, 7 January 2022, Pages D497–D508, https://doi.org/10.1093/nar/gkab975

• If using gget enrichr, please also cite:

  • Chen EY, Tan CM, Kou Y, Duan Q, Wang Z, Meirelles GV, Clark NR, Ma'ayan A. Enrichr: interactive and collaborative HTML5 gene list enrichment analysis tool. BMC Bioinformatics. 2013; 128(14). https://doi.org/10.1186/1471-2105-14-128

  • Kuleshov MV, Jones MR, Rouillard AD, Fernandez NF, Duan Q, Wang Z, Koplev S, Jenkins SL, Jagodnik KM, Lachmann A, McDermott MG, Monteiro CD, Gundersen GW, Ma'ayan A. Enrichr: a comprehensive gene set enrichment analysis web server 2016 update. Nucleic Acids Research. 2016; gkw377. doi: 10.1093/nar/gkw377

  • Xie Z, Bailey A, Kuleshov MV, Clarke DJB., Evangelista JE, Jenkins SL, Lachmann A, Wojciechowicz ML, Kropiwnicki E, Jagodnik KM, Jeon M, & Ma’ayan A. Gene set knowledge discovery with Enrichr. Current Protocols, 1, e90. 2021. doi: 10.1002/cpz1.90.

  If working with non-human/mouse datasets, please also cite:

  • Kuleshov MV, Diaz JEL, Flamholz ZN, Keenan AB, Lachmann A, Wojciechowicz ML, Cagan RL, Ma'ayan A. modEnrichr: a suite of gene set enrichment analysis tools for model organisms. Nucleic Acids Res. 2019 Jul 2;47(W1):W183-W190. doi: 10.1093/nar/gkz347. PMID: 31069376; PMCID: PMC6602483.

• If using gget info, please also cite:

  • Martin FJ, Amode MR, Aneja A, Austine-Orimoloye O, Azov AG, Barnes I, Becker A, Bennett R, Berry A, Bhai J, Bhurji SK, Bignell A, Boddu S, Branco Lins PR, Brooks L, Ramaraju SB, Charkhchi M, Cockburn A, Da Rin Fiorretto L, Davidson C, Dodiya K, Donaldson S, El Houdaigui B, El Naboulsi T, Fatima R, Giron CG, Genez T, Ghattaoraya GS, Martinez JG, Guijarro C, Hardy M, Hollis Z, Hourlier T, Hunt T, Kay M, Kaykala V, Le T, Lemos D, Marques-Coelho D, Marugán JC, Merino GA, Mirabueno LP, Mushtaq A, Hossain SN, Ogeh DN, Sakthivel MP, Parker A, Perry M, Piližota I, Prosovetskaia I, Pérez-Silva JG, Salam AIA, Saraiva-Agostinho N, Schuilenburg H, Sheppard D, Sinha S, Sipos B, Stark W, Steed E, Sukumaran R, Sumathipala D, Suner MM, Surapaneni L, Sutinen K, Szpak M, Tricomi FF, Urbina-Gómez D, Veidenberg A, Walsh TA, Walts B, Wass E, Willhoft N, Allen J, Alvarez-Jarreta J, Chakiachvili M, Flint B, Giorgetti S, Haggerty L, Ilsley GR, Loveland JE, Moore B, Mudge JM, Tate J, Thybert D, Trevanion SJ, Winterbottom A, Frankish A, Hunt SE, Ruffier M, Cunningham F, Dyer S, Finn RD, Howe KL, Harrison PW, Yates AD, Flicek P. Ensembl 2023. Nucleic Acids Res. 2023 Jan 6;51(D1):D933-D941. doi: 10.1093/nar/gkac958. PMID: 36318249; PMCID: PMC9825606.

  • Sayers EW, Beck J, Bolton EE, Brister JR, Chan J, Comeau DC, Connor R, DiCuccio M, Farrell CM, Feldgarden M, Fine AM, Funk K, Hatcher E, Hoeppner M, Kane M, Kannan S, Katz KS, Kelly C, Klimke W, Kim S, Kimchi A, Landrum M, Lathrop S, Lu Z, Malheiro A, Marchler-Bauer A, Murphy TD, Phan L, Prasad AB, Pujar S, Sawyer A, Schmieder E, Schneider VA, Schoch CL, Sharma S, Thibaud-Nissen F, Trawick BW, Venkatapathi T, Wang J, Pruitt KD, Sherry ST. Database resources of the National Center for Biotechnology Information. Nucleic Acids Res. 2024 Jan 5;52(D1):D33-D43. doi: 10.1093/nar/gkad1044. PMID: 37994677; PMCID: PMC10767890.

  • The UniProt Consortium , UniProt: the Universal Protein Knowledgebase in 2023, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D523–D531, https://doi.org/10.1093/nar/gkac1052

• If using gget muscle, please also cite:

  • Edgar RC (2021), MUSCLE v5 enables improved estimates of phylogenetic tree confidence by ensemble bootstrapping, bioRxiv 2021.06.20.449169. https://doi.org/10.1101/2021.06.20.449169

• If using gget opentargets, please also cite:

  • Ochoa D, Hercules A, Carmona M, Suveges D, Baker J, Malangone C, Lopez I, Miranda A, Cruz-Castillo C, Fumis L, Bernal-Llinares M, Tsukanov K, Cornu H, Tsirigos K, Razuvayevskaya O, Buniello A, Schwartzentruber J, Karim M, Ariano B, Martinez Osorio RE, Ferrer J, Ge X, Machlitt-Northen S, Gonzalez-Uriarte A, Saha S, Tirunagari S, Mehta C, Roldán-Romero JM, Horswell S, Young S, Ghoussaini M, Hulcoop DG, Dunham I, McDonagh EM. The next-generation Open Targets Platform: reimagined, redesigned, rebuilt. Nucleic Acids Res. 2023 Jan 6;51(D1):D1353-D1359. doi: 10.1093/nar/gkac1046. PMID: 36399499; PMCID: PMC9825572.

• If using gget pdb, please also cite:

  • Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE. The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. doi: 10.1093/nar/28.1.235. PMID: 10592235; PMCID: PMC102472.

• If using gget ref or gget search, please also cite:

  • Martin FJ, Amode MR, Aneja A, Austine-Orimoloye O, Azov AG, Barnes I, Becker A, Bennett R, Berry A, Bhai J, Bhurji SK, Bignell A, Boddu S, Branco Lins PR, Brooks L, Ramaraju SB, Charkhchi M, Cockburn A, Da Rin Fiorretto L, Davidson C, Dodiya K, Donaldson S, El Houdaigui B, El Naboulsi T, Fatima R, Giron CG, Genez T, Ghattaoraya GS, Martinez JG, Guijarro C, Hardy M, Hollis Z, Hourlier T, Hunt T, Kay M, Kaykala V, Le T, Lemos D, Marques-Coelho D, Marugán JC, Merino GA, Mirabueno LP, Mushtaq A, Hossain SN, Ogeh DN, Sakthivel MP, Parker A, Perry M, Piližota I, Prosovetskaia I, Pérez-Silva JG, Salam AIA, Saraiva-Agostinho N, Schuilenburg H, Sheppard D, Sinha S, Sipos B, Stark W, Steed E, Sukumaran R, Sumathipala D, Suner MM, Surapaneni L, Sutinen K, Szpak M, Tricomi FF, Urbina-Gómez D, Veidenberg A, Walsh TA, Walts B, Wass E, Willhoft N, Allen J, Alvarez-Jarreta J, Chakiachvili M, Flint B, Giorgetti S, Haggerty L, Ilsley GR, Loveland JE, Moore B, Mudge JM, Tate J, Thybert D, Trevanion SJ, Winterbottom A, Frankish A, Hunt SE, Ruffier M, Cunningham F, Dyer S, Finn RD, Howe KL, Harrison PW, Yates AD, Flicek P. Ensembl 2023. Nucleic Acids Res. 2023 Jan 6;51(D1):D933-D941. doi: 10.1093/nar/gkac958. PMID: 36318249; PMCID: PMC9825606.

• If using gget seq, please also cite:

  • Martin FJ, Amode MR, Aneja A, Austine-Orimoloye O, Azov AG, Barnes I, Becker A, Bennett R, Berry A, Bhai J, Bhurji SK, Bignell A, Boddu S, Branco Lins PR, Brooks L, Ramaraju SB, Charkhchi M, Cockburn A, Da Rin Fiorretto L, Davidson C, Dodiya K, Donaldson S, El Houdaigui B, El Naboulsi T, Fatima R, Giron CG, Genez T, Ghattaoraya GS, Martinez JG, Guijarro C, Hardy M, Hollis Z, Hourlier T, Hunt T, Kay M, Kaykala V, Le T, Lemos D, Marques-Coelho D, Marugán JC, Merino GA, Mirabueno LP, Mushtaq A, Hossain SN, Ogeh DN, Sakthivel MP, Parker A, Perry M, Piližota I, Prosovetskaia I, Pérez-Silva JG, Salam AIA, Saraiva-Agostinho N, Schuilenburg H, Sheppard D, Sinha S, Sipos B, Stark W, Steed E, Sukumaran R, Sumathipala D, Suner MM, Surapaneni L, Sutinen K, Szpak M, Tricomi FF, Urbina-Gómez D, Veidenberg A, Walsh TA, Walts B, Wass E, Willhoft N, Allen J, Alvarez-Jarreta J, Chakiachvili M, Flint B, Giorgetti S, Haggerty L, Ilsley GR, Loveland JE, Moore B, Mudge JM, Tate J, Thybert D, Trevanion SJ, Winterbottom A, Frankish A, Hunt SE, Ruffier M, Cunningham F, Dyer S, Finn RD, Howe KL, Harrison PW, Yates AD, Flicek P. Ensembl 2023. Nucleic Acids Res. 2023 Jan 6;51(D1):D933-D941. doi: 10.1093/nar/gkac958. PMID: 36318249; PMCID: PMC9825606.

  • The UniProt Consortium , UniProt: the Universal Protein Knowledgebase in 2023, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D523–D531, https://doi.org/10.1093/nar/gkac1052

Disclaimer

gget is only as accurate as the databases/servers/APIs it queries from. The accuracy or reliability of the data is not guaranteed or warranted in any way and the providers disclaim liability of any kind whatsoever, including, without limitation, liability for quality, performance, merchantability and fitness for a particular purpose arising out of the use, or inability to use the data.

¡Bienvenidos!

gget es un programa gratuito de código fuente abierta de Terminal y Python que permite la consulta eficiente de bases de datos genómicas.

gget consiste en un conjunto de módulos separados pero interoperables, cada uno diseñado para facilitar un tipo de consulta de base de datos en una sola línea de código.

Las bases de datos consultadas por gget se actualizan continuamente, lo que a veces cambia su estructura. Los módulos gget se prueban automáticamente cada dos semanas y se actualizan para que coincidan con las nuevas estructuras de la base de datos cuando es necesario. Si encuentra algún problema, actualice a la última versión de gget usando pip install --upgrade gget. Si el problema persiste, informa el problema.

 
 Solicitar una nueva función 
 

Módulos gget

Estos son los módulos principales de gget. Haga clic en cualquier módulo para acceder a la documentación detallada.

Si usa gget en una publicación, por favor cite*:

Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

Lea el artículo aquí: https://doi.org/10.1093/bioinformatics/btac836

Gracias a Victor Garcia-Ruiz y Anna Karen Orta por su ayuda con la traduccion del sitio web.

✨ ¡Lo más reciente!

Versión ≥ 0.29.0 (25 de septiembre de 2024):

• Nuevos módulos:
  • gget cbio
  • gget opentargets
  • gget bgee
• gget enrichr ahora también soporta especies además de humano y ratón (mosca, levadura, gusano y pez) a través de modEnrichR
• gget mutate:
  gget mutate ahora fusionará secuencias idénticas en el archivo final por defecto. La creación de mutaciones fue vectorizada para disminuir el tiempo de ejecución. Se mejoró la verificación de la secuencia flanqueante para mutaciones no sustitutivas para asegurarse de que no se retenga ningún kmer silvestre en la secuencia que contiene la mutación. Se agregó varios nuevos argumentos para personalizar la generación de secuencias y la salida.
• gget cosmic:
  Se agregó soporte para pantallas de genes así como dirigidas. El archivo CSV creado para gget mutate ahora también contiene información sobre mutaciones de proteínas.
• gget ref:
  Se agregó opción de archivo de salida.
• gget info y gget seq:
  Se cambió a la API POST de Ensembl para aumentar la velocidad (nada cambia en el front end).
• Otros cambios "detrás de escena":
  • Pruebas unitarias reorganizadas para aumentar la velocidad y disminuir el código
  • Requisitos actualizados para permitir versiones más nuevas de mysql-connector
  • Soporte para Numpy>= 2.0

Versión ≥ 0.28.6 (2 de junio de 2024):

• Nuevo módulo: gget mutate
• gget cosmic: Ahora puedes descargar bases de datos completas de COSMIC utilizando el argumento download_cosmic
• gget ref: Ahora puede obtener la ensambladura del genoma GRCh27 usando species='human_grch37'
• gget search: Ajusta el acceso a los datos humanos a la estructura de la versión 112 de Ensembl (corrige issue 129)

Version ≥ 0.28.5 (May 29, 2024):

• Retirado debido a un error con 'logging' en gget.setup("alphafold") + mutaciones de inversión en gget mutate solo invierten la cadena en lugar de también calcular la hebra complementaria

Versión ≥ 0.28.4 (31 de enero de 2024):

• gget setup: soluciona el error con la ruta del archivo al ejecutar gget.setup("elm") en el sistema operativo Windows.

Versión ≥ 0.28.3 (22 de enero de 2024):

• gget search y gget ref ahora también admiten hongos 🍄, protistas 🌝 y metazoos de invertebrados 🐝 🐜 🐌 🐙 (además de vertebrados y plantas)
• Nuevo módulo: gget cosmic
• gget enrichr: corrige puntos de dispersión duplicados en el gráfico cuando los nombres de las rutas están duplicados
• gget elm:
  • Se cambió el nombre de la columna de resultados orto 'Ortholog_UniProt_ID' a 'Ortholog_UniProt_Acc' para reflejar correctamente el contenido de la columna, que son accesos de UniProt. 'UniProt ID' se cambió a 'UniProt Acc' en la documentación para todos los módulos gget.
  • Se cambió el nombre de la columna de resultados ortogonales 'motif_in_query' a 'motif_inside_subject_query_overlap'.
  • Se agregó información del dominio de interacción a los resultados (nuevas columnas: "InteractionDomainId", "InteractionDomainDescription", "InteractionDomainName").
  • La cadena de expresiones regulares para coincidencias de expresiones regulares se encapsuló de la siguiente manera: "(?=(regex))" (en lugar de pasar directamente la cadena de expresiones regulares "regex") para permitir capturar todas las apariciones de un motivo cuando la longitud del motivo es variable y hay son repeticiones en la secuencia (https://regex101.com/r/HUWLlZ/1).
• gget setup: utilice el argumento out para especificar un directorio en el que se descargará la base de datos ELM. Completa esta solicitud de función.
• gget Diamond: El comando DIAMOND ahora se ejecuta con el indicador --ignore-warnings, lo que permite secuencias de nicho, como secuencias de aminoácidos que solo contienen caracteres de nucleótidos y secuencias repetidas. Esto también es válido para las alineaciones DIAMOND realizadas dentro de gget elm.
• Cambio de back-end de gget ref y gget search: la versión actual de Ensembl se obtiene del nuevo archivo de versión en el sitio FTP de Ensembl para evitar errores durante la carga de nuevos lanzamientos.
• gget search:
  • Los resultados del enlace FTP (--ftp) se guardan en formato de archivo txt en lugar de json.
  • Se corrigieron enlaces URL al resumen de genes de Ensembl para especies con un nombre de subespecie e invertebrados.
• gget ref:
  • Cambios de back-end para aumentar la velocidad.
  • Nuevo argumento: list_iv_species para enumerar todas las especies de invertebrados disponibles (se puede combinar con el argumento release para obtener todas las especies disponibles de una liberación específica de Ensembl)

Versión ≥ 0.28.2 (15 de noviembre de 2023):

• gget info: devuelve un mensaje de error cuando el servidor NCBI falla por un motivo distinto a un error de recuperación (esto es un error en el lado del servidor en lugar de un error con gget)
• Reemplace el argumento obsoleto 'texto' para los métodos de tipo find() siempre que se usen con la dependencia BeautifulSoup
• gget elm: Elimina instancias de falsos positivos y verdaderos negativos de los resultados devueltos.
• gget elm: agrega el argumento expand

Versión ≥ 0.28.0 (5 de noviembre de 2023):

• Documentación actualizada de gget muscle para agregar un tutorial sobre cómo visualizar secuencias con diferentes longitudes de nombres de secuencia + ligero cambio en la visualización devuelta para que sea un poco más sólida ante diferentes nombres de secuencia
• gget muscle ahora también permite una lista de secuencias como entrada (como alternativa a proporcionar la ruta a un archivo FASTA)
• Permitir filtro de genes faltante para gget cellxgene (corrige error)
• gget seq: permite nombres de genes faltantes (correccione [https://github.com/pachterlab/gget/issues/107](https://github.com/pachterlab/gget /números/107))
• Nuevos argumentos para gget enrichr: use el argumento kegg_out y kegg_rank para crear una imagen de la vía KEGG con los genes del análisis de enriquecimiento resaltados (gracias a [este PR](https ://github.com/pachterlab/gget/pull/106) por Noriaki Sato)
• Nuevos módulos: gget elm y gget Diamond

Versión ≥ 0.27.9 (7 de agosto de 2023):

• Nuevos argumentos para gget enrichr: use el argumento background_list para proporcionar una lista de genes 'background'
• gget search ahora también busca sinónimos Ensembl (además de nombres y descripciones de genes) para obtener resultados de búsqueda más completos (gracias a Samuel Klein por la sugerencia)

Versión ≥ 0.27.8 (12 de julio de 2023):

• Nuevo argumento para gget search: especifique la versión de Ensembl desde la cual se obtiene la información con -r --release
• Se corrigió un error en gget pdb (este error se introdujo en la versión 0.27.5)

Versión ≥ 0.27.7 (15 de mayo de 2023):

• Se movieron las dependencias para los módulos gget gpt y gget cellxgene de los requisitos instalados automáticamente a gget setup
• Dependencias gget alphafold actualizadas para compatibilidad con Python >= 3.10
• Se agregó el argumento census_version a gget cellxgene

Versión ≥ 0.27.6 (1 de mayo de 2023) (TIRO debido a problemas con las dependencias -> reemplazada por la versión 0.27.7):

• Gracias a el PR de Tomás Di Domenico: gget search ahora también puede consultar los ID de plantas 🌱 Ensembl
• Nuevo módulo: gget cellxgene

Versión ≥ 0.27.5 (6 de abril de 2023):

• Se actualizó gget search para que funcione correctamente con la nueva versión de Pandas 2.0.0 (lanzado el 3 de abril de 2023), además de versiones anteriores de Pandas
• Se actualizó gget info con nuevos banderas uniprot y ncbi que permiten desactivar los resultados de estas bases de datos de forma independiente para ahorrar tiempo de ejecución (nota: el indicador ensembl_only quedó obsoleto)
• Todos los módulos gget ahora tienen una bandera -q / --quiet (para Python: verbose=False) para desactivar la información de progreso

Versión ≥ 0.27.4 (19 de marzo de 2023):

• Nuevo módulo: gget gpt

Versión ≥ 0.27.3 (11 de marzo de 2023):

• gget info excluye los ID de PDB de forma predeterminada para aumentar la velocidad (los resultados de PDB se pueden incluir usando la marca --pdb / pdb=True).

Versión ≥ 0.27.2 (1 de enero de 2023):

• Se actualizó gget alphafold a DeepMind's AlphaFold v2.3.0 (incluidos los nuevos argumentos multimer_for_monomer y multimer_recycles)

Versión ≥ 0.27.0 (10 de diciembre de 2022):

• Se actualizó gget alphafold para que coincida con los cambios recientes de DeepMind
• Número de versión actualizado para que coincida con la edad de el creador de gget siguiendo una larga tradición de laboratorio de Pachter

Versión ≥ 0.3.13 (11 de noviembre de 2022):

• Tiempo de ejecución reducido para gget enrichr y gget archs4 cuando se usa con ID de Ensembl

Versión ≥ 0.3.12 (10 de noviembre de 2022):

• gget info ahora también devuelve datos de localización subcelular de UniProt
• El nuevo indicador gget info ensembl_only devuelve solo los resultados de Ensembl
• Tiempo de ejecución reducido para gget info y gget seq

Versión ≥ 0.3.11 (7 de septiembre de 2022):

• Nuevo módulo: gget pdb

Versión ≥ 0.3.10 (2 de septiembre de 2022):

• gget alphafold ahora también devuelve valores pLDDT para generar gráficos sin volver a ejecutar el programa (consulte también las preguntas frecuentes de gget alphafold)

Versión ≥ 0.3.9 (25 de agosto de 2022):

• Instrucciones de instalación de openmm actualizadas para gget alphafold

Versión ≥ 0.3.8 (12 de agosto de 2022):

• Se corrigieron los requisitos de versión de mysql-connector-python

Versión ≥ 0.3.7 (9 de agosto de 2022):

• NOTA: El sitio FTP de Ensembl cambió su estructura el 8 de agosto de 2022. Actualice a la versión gget ≥ 0.3.7 si usa obtener ref

Versión ≥ 0.3.5 (6 de agosto de 2022):

• Nuevo módulo: gget alphafold

Versión ≥ 0.2.6 (7 de julio de 2022):

• ¡gget ref ahora admite genomas de plantas! 🌱

Versión ≥ 0.2.5 (30 de junio de 2022):

• NOTA: UniProt cambió la estructura de su API el 28 de junio de 2022. Actualice a la versión gget ≥ 0.2.5 si usa alguno de los módulos que consultan datos de UniProt (gget info y gget seq).

Versión ≥ 0.2.3: (26 de junio de 2022):

• JSON ahora es el formato de regreso predeterminado para la Terminal para los módulos que anteriormente devolvían el formato de data frame (CSV) (el formato se puede convertir a data frame/CSV usando la bandera [-csv][--csv]). El formato data frame/CSV sigue siendo el formato de regreso predeterminada para Python (Jupyter Lab/Google Colab) (y se puede convertir a JSON con json=True).
• Para todos los módulos, el primer parámetro requerido se convirtió en un parámetro posicional y ya no debe nombrarse en la línea de comandos, p. ej. gget ref -s human → gget ref human.
• gget info: [--expand] está en desuso. El módulo ahora siempre devolverá toda la información disponible.
• Ligeros cambios en la salida devuelta por gget info, incluida la devolución de los ID de Ensembl versionados.
• gget info y gget seq ahora son compatibles con las IDs de WormBase y FlyBase.
• Ahora también se pueden ingresar IDs de tipo Ensembl a gget archs4 y gget enrichr con la bandera [-e][--ensembl] (ensembl=True para Python (Jupyter Lab / Google Colab)).
• El parámetro seqtype de gget seq fue reemplazado por la bandera [-t][--translate] (translate=True/False para Python (Jupyter Lab / Google Colab)) que devolverá secuencias de nucleótidos (False) o aminoácidos (True).
• El parámetro seqtype de gget search se renombró a id_type (aún tomando los mismos parámetros 'gene' o 'transcript').

Usuarios activos del sitio web de gget desde su creación:

🧑‍🤝‍🧑 Dependientes

Las siguientes aplicaciones se basan en gget:

• Therapeutics Data Commons (TDC)
  Base de inteligencia artificial para la ciencia terapéutica (código fuente, artículo en Nat Chem Bio) del laboratorio de Inteligencia Artificial para Medicina y Ciencia de Harvard.
• BioDiscoveryAgent
  BioDiscoveryAgent es un agente de IA basado en modelos de lenguaje para el diseño en bucle cerrado de experimentos de perturbación genética (preprint) del Proyecto de Análisis de Redes de Stanford.
• DeepChopper
  Modelos de lenguaje para identificar lecturas artificiales quiméricas en datos de secuenciación directa de ARN de NanoPore por el laboratorio de Yang en Northwestern.
• BRAD
  Un chatbot impulsado por un modelo de lenguaje para bioinformática (documentación, página principal del proyecto).
• scPRINT
  scPRINT es un modelo transformer grande diseñado para inferir redes génicas (conexiones entre genes que explican el perfil de expresión de la célula) a partir de datos de scRNAseq (preprint).
• AnoPrimer
  AnoPrimer es un paquete de Python para el diseño de cebadores en An. gambiae y An. funestus, teniendo en cuenta la variación genética en especímenes de genomas completos secuenciados de la naturaleza en datos de malariagen.
• AvaTaR
  Optimización de Agentes de LLM para Recuperación de Conocimiento Asistida por Herramientas (NeurIPS 2024) por el laboratorio de James Zou en la Universidad de Stanford.
• GRLDrugProp
  Aprendizaje de representación de grafos para modelar propiedades de fármacos.
• Implementación en Rust de gget: https://github.com/noamteyssier/ggetrs
• https://github.com/Superbio-ai/getbio
• https://github.com/yonniejon/AchillesPrediction
• https://github.com/ELELAB/cancermuts
• https://github.com/Benoitdw/SNPrimer
• https://github.com/louisjoecodes/a16z-hackathon-project
• https://github.com/EvX57/BACE1-Drug-Discovery
• https://github.com/vecerkovakaterina/hidden-genes-msc
• https://github.com/vecerkovakaterina/llm_bioinfo_agent
• https://github.com/greedjar74/upstage_AI_Lab
• https://github.com/alphavector/all

Ver también: https://github.com/pachterlab/gget/network/dependents

📃 Publicaciones destacadas

• David Bradley et al., The fitness cost of spurious phosphorylation. The EMBO Journal (2024). DOI: 10.1038/s44318-024-00200-7
• Mikael Nilsson et al., Resolving thyroid lineage cell trajectories merging into a dual endocrine gland in mammals. Nature Portfolio (en revisión) (2024). DOI: 10.21203/rs.3.rs-5278325/v1
• Avasthi P et al., Repeat expansions associated with human disease are present in diverse organisms. Arcadia (2024). DOI: 10.57844/arcadia-e367-8b55
• Ibrahim Al Rayyes et al., Single-Cell Transcriptomics Reveals the Molecular Logic Underlying Ca2+ Signaling Diversity in Human and Mouse Brain. bioRxiv (2024). DOI: 10.1101/2024.04.26.591400
• David R. Blair & Neil Risch. Dissecting the Reduced Penetrance of Putative Loss-of-Function Variants in Population-Scale Biobanks. medRxiv (2024). DOI: 10.1101/2024.09.23.24314008
• Shanmugampillai Jeyarajaguru Kabilan et al., Molecular modelling approaches for the identification of potent Sodium-Glucose Cotransporter 2 inhibitors from Boerhavia diffusa for the potential treatment of chronic kidney disease. Journal of Computer-Aided Molecular Design (en revisión) (2024). DOI: 10.21203/rs.3.rs-4520611/v1
• Joseph M Rich et al., The impact of package selection and versioning on single-cell RNA-seq analysis. bioRxiv (2024). DOI: 10.1101/2024.04.04.588111
• Sanjay C. Nagi et al., AnoPrimer: Primer Design in malaria vectors informed by range-wide genomic variation. Wellcome Open Research (2024).
• Yasmin Makki Mohialden et al., A survey of the most recent Python packages for use in biology. NeuroQuantology (2023). DOI: 10.48047/NQ.2023.21.2.NQ23029
• Kimberly Siletti et al., Transcriptomic diversity of cell types across the adult human brain. Science (2023). DOI: 10.1126/science.add7046
• Beatriz Beamud et al., Genetic determinants of host tropism in Klebsiella phages. Cell Reports (2023). DOI: 10.1016/j.celrep.2023.112048
• Nicola A. Kearns et al., Generation and molecular characterization of human pluripotent stem cell-derived pharyngeal foregut endoderm. Cell Reports (2023). DOI: 10.1016/j.devcel.2023.08.024
• Jonathan Rosenski et al., Predicting gene knockout effects from expression data. BMC Medical Genomics (2023). DOI: 10.1186/s12920-023-01446-6
• Peter Overby et al., Pharmacological or genetic inhibition of Scn9a protects beta-cells while reducing insulin secretion in type 1 diabetes. bioRxiv (2023). DOI: 10.1101/2023.06.11.544521
• Mingze Dong et al., Deep identifiable modeling of single-cell atlases enables zero-shot query of cellular states. bioRxiv (2023). DOI: 10.1101/2023.11.11.566161

📰 Noticias

• Documental corto sobre gget: https://youtu.be/cVR0k6Mt97o
• Episodio de podcast para el Prototype Fund Public Interest Podcast sobre la importancia del software de código abierto y su papel en la investigación académica (en alemán): https://public-interest-podcast.podigee.io/33-pips4e4
• Anuncio del Prototype Fund: https://prototypefund.de/project/gget-genomische-datenbanken

Instalación

pip install --upgrade gget

Alternativa:

conda install -c bioconda gget

Para uso en Jupyter Lab / Google Colab:

import gget

🪄 Guía de inicio rápido

Terminal:

# Obtenga todos los FTP de anotaciones y referencias de Homo sapiens de la última versión de Ensembl
$ gget ref homo_sapiens

# Obtenga IDs de Ensembl de genes humanos con "ace2" o "angiotensin converting enzyme 2" en su nombre/descripción
$ gget search -s homo_sapiens 'ace2' 'angiotensin converting enzyme 2'

# Busque el gen ENSG00000130234 (ACE2) y su transcripción ENST00000252519
$ gget info ENSG00000130234 ENST00000252519

# Obtenga la secuencia de aminoácidos de la transcripción canónica del gen ENSG00000130234
$ gget seq --translate ENSG00000130234

# Rápidamente encuentra la ubicación genómica de la secuencia de aminoácidos
$ gget blat MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# BLAST la secuencia de aminoácidos
$ gget blast MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# Alinee múltiples secuencias de nucleótidos o aminoácidos entre sí (también acepta la ruta al archivo FASTA)  
$ gget muscle MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS

# Alinee una o más secuencias de aminoácidos con una referencia (que contiene una o más secuencias) (BLAST local) (también acepta rutas a archivos FASTA)  
$ gget diamond MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS -ref MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS

# Alinea secuencias de nucleótidos o aminoácidos en un archivo FASTA
$ gget muscle path/to/file.fa

# Use Enrichr para un análisis de ontología de una lista de genes
$ gget enrichr -db ontology ACE2 AGT AGTR1 ACE AGTRAP AGTR2 ACE3P

# Obtene la expresión en tejido humano del gen ACE2
$ gget archs4 -w tissue ACE2

# Obtenga la estructura de la proteína (en formato PDB) de ACE2 (ID de PDB devuelta por gget info)
$ gget pdb 1R42 -o 1R42.pdb

# Encuentre motivos lineales eucarióticos (ELM) en una secuencia de aminoácidos
$ gget setup elm        # solo debe ejecutarse una vez
$ gget elm -o results MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# Obtene una matriz de recuento de scRNAseq (formato AnnData) basada en genes, tejidos y tipos de células especificados (especie predeterminada: humano)
$ gget setup cellxgene  # solo debe ejecutarse una vez
$ gget cellxgene --gene ACE2 SLC5A1 --tissue lung --cell_type 'mucus secreting cell' -o example_adata.h5ad

# Predice la estructura proteica de GFP a partir de su secuencia de aminoácidos
$ gget setup alphafold  # solo debe ejecutarse una vez
$ gget alphafold MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Python (Jupyter Lab / Google Colab):

import gget
gget.ref("homo_sapiens")
gget.search(["ace2", "angiotensin converting enzyme 2"], "homo_sapiens")
gget.info(["ENSG00000130234", "ENST00000252519"])
gget.seq("ENSG00000130234", translate=True)
gget.blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.muscle(["MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", "MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS"])
gget.diamond("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", reference="MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS")
gget.enrichr(["ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"], database="ontology", plot=True)
gget.archs4("ACE2", which="tissue")
gget.pdb("1R42", save=True)

gget.setup("elm")         # solo debe ejecutarse una vez
ortho_df, regex_df = gget.elm("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")

gget.setup("cellxgene")   # solo debe ejecutarse una vez
gget.cellxgene(gene = ["ACE2", "SLC5A1"], tissue = "lung", cell_type = "mucus secreting cell")

gget.setup("alphafold")   # solo debe ejecutarse una vez
gget.alphafold("MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK")

Use a gget con R usando reticulate:

system("pip install gget")
install.packages("reticulate")
library(reticulate)
gget <- import("gget")

gget$ref("homo_sapiens")
gget$search(list("ace2", "angiotensin converting enzyme 2"), "homo_sapiens")
gget$info(list("ENSG00000130234", "ENST00000252519"))
gget$seq("ENSG00000130234", translate=TRUE)
gget$blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget$blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget$muscle(list("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", "MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS"), out="out.afa")
gget$diamond("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", reference="MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS")
gget$enrichr(list("ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"), database="ontology")
gget$archs4("ACE2", which="tissue")
gget$pdb("1R42", save=TRUE)

Más ejemplos

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget alphafold 🪢

Predice la estructura en 3D de cualquier proteína derivada de su secuencia de aminoácidos usando una versión simplificada del algoritmo AlphaFold2 de DeepMind, originalmente producido y publicado para AlphaFold Colab.
Resultado: Predicción de la estructura (en formato PDB) y el errór de alineación (en formato json).

Antes de usar gget alphafold por primera vez:

1. Instale openmm v7.5.1 (o v7.7.0 para Python >= 3.10) ejecutando el siguiente comando desde la línea de comando:
   conda install -qy conda==4.13.0 && conda install -qy -c conda-forge openmm=7.5.1
   (reemplazar con openmm=7.7.0 para Python >= 3.10)
   Recomendación: siga con conda update -qy conda para actualizar conda a la última versión.
2. Corre gget setup alphafold / gget.setup("alphafold") (ver también gget setup). Al ejecutar gget setup alphafold / gget.setup("alphafold") se descargará e instalará la última versión de AlphaFold2 alojada en el AlphaFold GitHub Repo. Puede volver a ejecutar este comando en cualquier momento para actualizar el software cuando hay una nueva versión de AlphaFold.

Parámetro posicional
sequence
Secuencia de aminoácidos (str), o una lista de secuencias (gget alphafold automaticamente usa el algoritmo del multímero si múltiples secuencias son ingresadas), o una ruta a un archivo formato FASTA.

Parámetros optionales
-mr --multimer_recycles
El algoritmo de multímero se reciclara hasta que las predicciones dejen de cambiar, el limite de ciclos esta indicado aqui. Por defecto: 3
Para obtener más exactitud, ajusta este limite a 20 (al costo de ejecuciones mas tardadas).

-o --out
Ruta a la carpeta para guardar los resultados de la predicción (str). Por defecto: "./[fecha_tiempo]_gget_alphafold_prediction".

Banderas
-mfm --multimer_for_monomer
Usa el algoritmo de multímero para un monómero.

-r --relax
Relaja el mejor modelo con el algoritmo AMBER.

-q --quiet
Uso limitado para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False.

plot
Solo para Python. plot=True provée una visualización interactiva de la predicción con el errór de alineación en 3D con py3Dmol y matplotlib (por defecto: True).

show_sidechains
Solo para Python. show_sidechains=True incluye las cadenas laterales de proteínas en el esquema (por defecto: True).

Ejemplo

# Predice la estructura de una proteína derivada de su secuencia de aminoácidos
gget alphafold MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH

# Encuentra secuencias similares previamente depositadas en el PDB para análisis comparativo
gget blast --database pdbaa MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH

# Busca los archivos PDB de estructuras similares resultantes de gget blast para comparar y obtener una medida de calidad del modelo predecido.
gget pdb 3UQ3 -o 3UQ3.pdb
gget pdb 2K42 -o 2K42.pdb

# Python
# Predice la estructura de una proteína derivada de su secuencia de aminoácidos
gget.alphafold("MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH")

# Encuentra secuencias similares previamente depositadas en el PDB para análisis comparativo
gget.blast("MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH", database="pdbaa")

# Busca los archivos PDB de estructuras similares resultantes de gget blast para comparar y obtener una medida de calidad del modelo predecido.
gget.pdb("3UQ3", save=True)
gget.pdb("2K42", save=True)

→ gget alphafold produce la estructura predecida (en formato PDB) y el errór de alineación (en formato json) en una nueva carpeta ("./[fecha_tiempo]_gget_alphafold_prediction"). Este ejemplo demuestra como usar gget blast y gget pdb para correr un análisis comparativo. Los archivos PDB se pueden ver en 3D con RCSB 3D view, o usando programas como PyMOL o Blender. Para comparar múltiples archivos PDB, use RCSB alignment. Python también produce esquemas interactivos, los cuales se pueden generar de los archivos PDB y JSON, como es describido en gget alphafold FAQ Q4.

Tutoriales

🔗 Google Colab tutorial

🔗 Predicción de la estructura de proteínas con comparación con estructuras cristalinas relacionadas

🔗 gget alphafold - preguntas más frecuentes

Citar

Si utiliza gget alphafold en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Jumper, J., Evans, R., Pritzel, A. et al. Highly accurate protein structure prediction with AlphaFold. Nature 596, 583–589 (2021). https://doi.org/10.1038/s41586-021-03819-2

Y, si corresponde:

• Evans, R. et al. Protein complex prediction with AlphaFold-Multimer. bioRxiv 2021.10.04.463034; https://doi.org/10.1101/2021.10.04.463034

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no es especificado de otra manera. Las banderas son designadas como cierto o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede obtener desde Terminal con la bandera -h --help.

gget archs4 🐁

Encuentra los genes más correlacionados a un gen de interés, o bién, encuentra los tejidos donde un gen se expresa usando la base de datos ARCHS4.
Produce: Resultados en formato JSON (Terminal) o Dataframe/CSV (Python).

Parámetro posicional
gene
Nombre corto (símbolo del gen) del gen de interés, p. ej. STAT4.
Alternativamente: usa la bandera --ensembl para ingresar un ID tipo Ensembl, p. ej. ENSG00000138378.

Parámetros optionales
-w --which
'correlation' (correlación; se usa por defecto) o 'tissue' (tejido).
'correlation' produce una tabla que contiene los 100 genes más correlacionados con el gen de interés. La correlación de Pearson se calcula de todas las muestras y tejidos en ARCHS4.
'tissue' produce un atlas de expresión tisular calculado de todas las muestras humanas o de ratón (según lo definido usando el parámetro --species (especies)) en ARCHS4.

-s --species
'human' (humano; se usa por defecto) o 'mouse' (ratón).
Define si se usan muestras humanas o de ratón de ARCHS4.
(Solo aplica para el atlas de expresión tisular.)

-o --out
Ruta al archivo en el que se guardarán los resultados, p. ej. ruta/al/directorio/resultados.csv (o .json). Por defecto: salida estándar (STDOUT).
Para Python, use save=True para guardar los resultados en el directorio de trabajo actual.

Banderas
-e --ensembl
Usa esta bandera si gene se ingresa como ID tipo Ensembl.

-csv --csv
Solo para Terminal. Produce los resultados en formato CSV.
Para Python, usa json=True para obtener los resultados en formato JSON.

-q --quiet
Solo para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False para impedir la información de progreso de ser exhibida durante la ejecución del programa.

Ejemplo

gget archs4 ACE2

# Python
gget.archs4("ACE2")

→ Produce los 100 genes más correlacionados con el gen ACE2:

gget archs4 -w tissue ACE2

# Python
gget.archs4("ACE2", which="tissue")

→ Produce la expresión tisular de ACE2 (por defecto, se utilizan datos humanos):

Consulte este tutorial de Dave Tang, quien escribió un script R para crear esta visualización con los resultados de gget archs4 en formato JSON:

Más ejemplos

Citar

Si utiliza gget archs4 en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Lachmann A, Torre D, Keenan AB, Jagodnik KM, Lee HJ, Wang L, Silverstein MC, Ma’ayan A. Massive mining of publicly available RNA-seq data from human and mouse. Nature Communications 9. Article number: 1366 (2018), doi:10.1038/s41467-018-03751-6

• Bray NL, Pimentel H, Melsted P and Pachter L, Near optimal probabilistic RNA-seq quantification, Nature Biotechnology 34, p 525--527 (2016). https://doi.org/10.1038/nbt.3519

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget bgee 🐝

Obtenga datos de ortología y expresión genética de Bgee utilizando IDs de Ensembl.
Resultado: JSON/CSV (línea de comandos) o marco de datos (Python).

Si estás interesado específicamente en datos de expresión génica humana, considera usar gget opentargets o gget archs4 en su lugar. gget bgee tiene menos datos, pero admite más especies.

Este módulo fue escrito por Sam Wagenaar.

Argumento posicional
ens_id
ID de gen Ensembl, por ejemplo, ENSG00000169194 o ENSSSCG00000014725.

NOTA: Algunas de las especies en Bgee no están en Ensembl, y para ellas puede utilizar los ID de genes del NCBI, p. 118215821 (un gen en Anguilla anguilla).

Argumentos requeridos
-t --type
Tipo de datos a obtener. Opciones: orthologs, expression.

Argumentos opcionales
-o --out
Ruta al archivo JSON donde se guardarán los resultados, por ejemplo, path/to/directory/results.json. Por defecto: Salida estándar.

Banderas
-csv --csv
Solo en línea de comandos. Devuelve la salida en formato CSV, en lugar de formato JSON.
Python: Usa json=True para devolver la salida en formato JSON.

-q --quiet
Solo en línea de comandos. Evita que se muestre la información de progreso.
Python: Usa verbose=False para evitar que se muestre la información de progreso.

Ejemplos

Obtener ortólogos para un gen

gget bgee ENSSSCG00000014725 -t orthologs

import gget
gget.bgee("ENSSSCG00000014725", type="orthologs")

→ Devuelve ortólogos para el gen con el ID de Ensembl ENSSSCG00000014725.

Obtener datos de expresión génica para un gen

gget bgee ENSSSCG00000014725 -t expression

import gget
gget.bgee("ENSSSCG00000014725", type="expression")

→ Devuelve datos de expresión génica para el gen con el ID de Ensembl ENSSSCG00000014725.

Más ejemplos

Citar

Si utiliza gget bgee en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Frederic B Bastian, Julien Roux, Anne Niknejad, Aurélie Comte, Sara S Fonseca Costa, Tarcisio Mendes de Farias, Sébastien Moretti, Gilles Parmentier, Valentine Rech de Laval, Marta Rosikiewicz, Julien Wollbrett, Amina Echchiki, Angélique Escoriza, Walid H Gharib, Mar Gonzales-Porta, Yohan Jarosz, Balazs Laurenczy, Philippe Moret, Emilie Person, Patrick Roelli, Komal Sanjeev, Mathieu Seppey, Marc Robinson-Rechavi (2021). The Bgee suite: integrated curated expression atlas and comparative transcriptomics in animals. Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D831–D847, https://doi.org/10.1093/nar/gkaa793

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Las banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget blast 💥

BLAST una secuencia de nucleótidos o aminoácidos a cualquier base de datos BLAST.
Produce: Resultados en formato JSON (Terminal) o Dataframe/CSV (Python).

Parámetro posicional
sequence
Secuencia de nucleótidos o aminoácidos, o una ruta a un archivo tipo FASTA o .txt.

Parámetros optionales
-p --program
'blastn', 'blastp', 'blastx', 'tblastn', o 'tblastx'.
Por defecto: 'blastn' para secuencias de nucleótidos; 'blastp' para secuencias de aminoácidos.

-db --database
'nt', 'nr', 'refseq_rna', 'refseq_protein', 'swissprot', 'pdbaa', o 'pdbnt'.
Por defecto: 'nt' para secuencias de nucleótidos; 'nr' para secuencias de aminoácidos.
Más información sobre los bases de datos BLAST

-l --limit
Limita el número de resultados producidos. Por defecto: 50.

-e --expect
Define el umbral de 'expect value'. Por defecto: 10.0.

-o --out
Ruta al archivo en el que se guardarán los resultados, p. ej. ruta/al/directorio/resultados.csv (o .json). Por defecto: salida estándar (STDOUT).
Para Python, usa save=True para guardar los resultados en el directorio de trabajo actual.

Banderas
-lcf --low_comp_filt
Activa el 'low complexity filter' (filtro de baja complejidad).

-mbo --megablast_off
Desactiva el algoritmo MegaBLAST. Por defecto: MegaBLAST esta activado (solo aplicable para blastn).

-csv --csv
Solo para Terminal. Produce los resultados en formato CSV.
Para Python, usa json=True para producir los resultados en formato JSON.

-q --quiet
Solo para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False para imipidir la informacion de progreso de ser exhibida durante la ejecución del programa.

wrap_text
Solo para Python. wrap_text=True muestra los resultados con texto envuelto para facilitar la lectura (por defecto: False).

Por ejemplo

gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# Python
gget.blast("MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR")

→ Produce los resultados BLAST de la secuencia de interés. gget blast automáticamente detecta esta secuencia como una secuencia de aminoácidos y, por lo tanto, establece el programa BLAST en blastp con la base de datos nr.

BLAST desde un archivo .fa o .txt:

gget blast fasta.fa

# Python
gget.blast("fasta.fa")

→ Produce los resultados BLAST de la primera secuencia contenida en el archivo 'fasta.fa'.

Más ejemplos

Citar

Si utiliza gget blast en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ. Basic local alignment search tool. J Mol Biol. 1990 Oct 5;215(3):403-10. doi: 10.1016/S0022-2836(05)80360-2. PMID: 2231712.

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget blat 🎯

Encuentra la ubicación genómica de una secuencia de nucleótidos o aminoácidos usando BLAT.
Produce: Resultados en formato JSON (Terminal) o Dataframe/CSV (Python).

Parámetro posicional
sequence
Secuencia de nucleótidos o aminoácidos, o una ruta a un archivo tipo FASTA o .txt.

Parámetros optionales
-st --seqtype
'DNA', 'protein', 'translated%20RNA', o 'translated%20DNA'.
Por defecto: 'DNA' para secuencias de nucleótidos; 'protein' para secuencias de aminoácidos.

-a --assembly
Ensamblaje del genoma. 'human' (hg38) (se usa por defecto), 'mouse' (mm39) (ratón), 'zebrafish' (taeGut2) (pinzón cebra),
o cualquiera de los ensamblajes de especies disponibles aquí (use el nombre corto del ensamblado, p. ej. 'hg38').

-o --out
Ruta al archivo en el que se guardarán los resultados, p. ej. ruta/al/directorio/resultados.csv (o .json). Por defecto: salida estándar (STDOUT).
Para Python, usa save=True para guardar los resultados en el directorio de trabajo actual.

Banderas
-csv --csv
Solo para Terminal. Produce los resultados en formato CSV.
Para Python, usa json=True para producir los resultados en formato JSON.

-q --quiet
Solo para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False para impedir la información de progreso de ser exhibida durante la ejecución del programa.

Ejemplo

gget blat -a taeGut2 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# Python
gget.blat("MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR", assembly="taeGut2")

→ Produce los resultados de BLAT para el ensamblaje taeGut2 (pinzón cebra). En este ejemplo, gget blat automáticamente detecta esta secuencia como una secuencia de aminoácidos y, por lo tanto, establece el tipo de secuencia (--seqtype) como proteína.

Màs ejemplos

Citar

Si utiliza gget blat en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Kent WJ. BLAT--the BLAST-like alignment tool. Genome Res. 2002 Apr;12(4):656-64. doi: 10.1101/gr.229202. PMID: 11932250; PMCID: PMC187518.

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget cbio 📖

Trazar mapas de calor de la genómica del cáncer utilizando datos de cBioPortal con IDs de Ensembl o nombres de genes.

Este módulo fue escrito por Sam Wagenaar.

Argumento posicional
subcommand
O bien search o plot

Subcomando search (Python: gget.cbio_search)

Buscar IDs de estudios de cBioPortal por palabra clave.
Formato de retorno: JSON (línea de comandos) o lista de cadenas (Python).
Nota: Esto no devuelve estudios con tipos de cáncer mixtos.

Argumento posicional
keywords
Lista de palabras clave separadas por espacios para buscar, por ejemplo breast lung.
Python: Pasa palabras clave como una lista de cadenas.

Subcomando plot (Python: gget.cbio_plot)

Graficar mapas de calor de genómica del cáncer utilizando datos de cBioPortal.
Formato de retorno: PNG (línea de comandos y Python).

Argumentos requeridos
-s --study_ids
Lista separada por espacios de IDs de estudios de cBioPortal, por ejemplo, msk_impact_2017 egc_msk_2023.

-g --genes
Lista separada por espacios de nombres de genes o IDs de Ensembl, por ejemplo, NOTCH3 ENSG00000108375.

Argumentos opcionales
-st --stratification
Columna por la cual estratificar los datos. Predeterminado: tissue.
Opciones:

• tissue
• cancer_type
• cancer_type_detailed
• study_id
• sample

-vt --variation_type
Tipo de variación a graficar. Predeterminado: mutation_occurrences.
Opciones:

• mutation_occurrences
• cna_nonbinary (Nota: la stratification debe ser 'sample' para esta opción)
• sv_occurrences
• cna_occurrences
• Consequence (Nota: la stratification debe ser 'sample' para esta opción)

-f --filter
Filtrar los datos por un valor específico en una columna específica, por ejemplo, study_id:msk_impact_2017.
Python: filter=(column, value)

-dd --data_dir
Directorio para almacenar los archivos de datos. Predeterminado: ./gget_cbio_cache.

-fd --figure_dir
Directorio para las figuras de salida. Predeterminado: ./gget_cbio_figures.

-fn --filename
Nombre del archivo de salida, relativo a figure_dir. Predeterminado: auto-generado.
Python: figure_filename.

-t --title
Título para la figura de salida. Predeterminado: auto-generado.
Python: figure_title.

-dpi --dpi
DPI de la figura de salida. Predeterminado: 100.

Banderas

-q --quiet
Solo en línea de comandos. Evita que se muestre la información de progreso.
Python: Usa verbose=False para evitar que se muestre la información de progreso.

-nc --no_confirm
Solo en línea de comandos. Omitir las confirmaciones de descarga.
Python: Usa confirm_download=True para habilitar las confirmaciones de descarga.

-sh --show
Mostrar la gráfica en una ventana (automático en notebooks de Jupyter).

Ejemplos

Encontrar todos los estudios de cBioPortal con tipos de cáncer que coinciden con palabras clave específicas:

gget cbio search esophag ovary ovarian

# Python
import gget
gget.cbio_search(['esophag', 'ovary', 'ovarian'])

→ Devuelve una lista de estudios con tipos de cáncer que coinciden con las palabras clave esophag, ovary, o ovarian.

['egc_tmucih_2015', 'egc_msk_2017', ..., 'msk_spectrum_tme_2022']

Graficar un mapa de calor de ocurrencias de mutaciones para genes específicos en un estudio específico:

gget cbio plot \
    -s msk_impact_2017 \
    -g AKT1 ALK FLT4 MAP3K1 MLL2 MLL3 NOTCH3 NOTCH4 PDCD1 RNF43 \
    -st tissue \
    -vt mutation_occurrences \
    -dpi 200 \
    -y

# Python
import gget
gget.cbio_plot(
    ['msk_impact_2017'],
    ['AKT1', 'ALK', 'FLT4', 'MAP3K1', 'MLL2', 'MLL3', 'NOTCH3', 'NOTCH4', 'PDCD1', 'RNF43'],
    stratification='tissue',
    variation_type='mutation_occurrences',
    dpi=200
)

→ Guarda un mapa de calor de ocurrencias de mutaciones para los genes especificados en el estudio especificado en ./gget_cbio_figures/Heatmap_tissue.png.

Graficar un mapa de calor de tipos de mutaciones para genes específicos en un estudio específico:

gget cbio plot \
    -s msk_impact_2017 \
    -g AKT1 ALK FLT4 MAP3K1 MLL2 MLL3 NOTCH3 NOTCH4 PDCD1 RNF43 \
    -st sample \
    -vt Consequence \
    -dpi 200 \
    -y

# Python
import gget
gget.cbio_plot(
    ['msk_impact_2017'],
    ['AKT1', 'ALK', 'FLT4', 'MAP3K1', 'MLL2', 'MLL3', 'NOTCH3', 'NOTCH4', 'PDCD1', 'RNF43'],
    stratification='sample',
    variation_type='Consequence',
    dpi=200,
)

→ Guarda un mapa de calor de tipos de mutaciones para los genes especificados en el estudio especificado en ./gget_cbio_figures/Heatmap_sample.png.

Graficar un mapa de calor de tipos de mutaciones para genes específicos en un estudio específico, filtrando por tejido::

gget cbio plot \
    -s msk_impact_2017 \
    -g AKT1 ALK FLT4 MAP3K1 MLL2 MLL3 NOTCH3 NOTCH4 PDCD1 RNF43 \
    -st sample \
    -vt Consequence \
    -f tissue:intestine \
    -dpi 200 \
    -y

# Python
import gget
gget.cbio_plot(
    ['msk_impact_2017'],
    ['AKT1', 'ALK', 'FLT4', 'MAP3K1', 'MLL2', 'MLL3', 'NOTCH3', 'NOTCH4', 'PDCD1', 'RNF43'],
    stratification='sample',
    variation_type='Consequence',
    filter=('tissue', 'intestine'),
    dpi=200,
)

→ Guarda un mapa de calor de tipos de mutaciones para los genes especificados en el estudio especificado, filtrado por tejido, en ./gget_cbio_figures/Heatmap_sample_intestine.png.

Graficar un mapa de calor con un título y nombre de archivo personalizados::

gget cbio plot \
    -s msk_impact_2017 \
    -g AKT1 ALK FLT4 MAP3K1 MLL2 MLL3 NOTCH3 NOTCH4 PDCD1 RNF43 \
    -st sample \
    -vt Consequence \
    -f tissue:intestine \
    -dpi 200 \
    -y \
    -t "Intestinal Mutations" \
    -fn intestinal_mutations.png

# Python
import gget
gget.cbio_plot(
    ['msk_impact_2017'],
    ['AKT1', 'ALK', 'FLT4', 'MAP3K1', 'MLL2', 'MLL3', 'NOTCH3', 'NOTCH4', 'PDCD1', 'RNF43'],
    stratification='sample',
    variation_type='Consequence',
    filter=('tissue', 'intestine'),
    dpi=200,
    figure_title='Intestinal Mutations',
    figure_filename='intestinal_mutations.png'
)

→ Guarda un mapa de calor de los tipos de mutaciones para los genes especificados en el estudio especificado, filtrado por tejido, con el título "Mutaciones intestinales" en ./gget_cbio_figures/intestinal_mutations.png.

Más ejemplos

Citar

Si utiliza gget cbio en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Cerami E, Gao J, Dogrusoz U, Gross BE, Sumer SO, Aksoy BA, Jacobsen A, Byrne CJ, Heuer ML, Larsson E, Antipin Y, Reva B, Goldberg AP, Sander C, Schultz N. The cBio cancer genomics portal: an open platform for exploring multidimensional cancer genomics data. Cancer Discov. 2012 May;2(5):401-4. doi: 10.1158/2159-8290.CD-12-0095. Erratum in: Cancer Discov. 2012 Oct;2(10):960. PMID: 22588877; PMCID: PMC3956037.

• Gao J, Aksoy BA, Dogrusoz U, Dresdner G, Gross B, Sumer SO, Sun Y, Jacobsen A, Sinha R, Larsson E, Cerami E, Sander C, Schultz N. Integrative analysis of complex cancer genomics and clinical profiles using the cBioPortal. Sci Signal. 2013 Apr 2;6(269):pl1. doi: 10.1126/scisignal.2004088. PMID: 23550210; PMCID: PMC4160307.

• de Bruijn I, Kundra R, Mastrogiacomo B, Tran TN, Sikina L, Mazor T, Li X, Ochoa A, Zhao G, Lai B, Abeshouse A, Baiceanu D, Ciftci E, Dogrusoz U, Dufilie A, Erkoc Z, Garcia Lara E, Fu Z, Gross B, Haynes C, Heath A, Higgins D, Jagannathan P, Kalletla K, Kumari P, Lindsay J, Lisman A, Leenknegt B, Lukasse P, Madela D, Madupuri R, van Nierop P, Plantalech O, Quach J, Resnick AC, Rodenburg SYA, Satravada BA, Schaeffer F, Sheridan R, Singh J, Sirohi R, Sumer SO, van Hagen S, Wang A, Wilson M, Zhang H, Zhu K, Rusk N, Brown S, Lavery JA, Panageas KS, Rudolph JE, LeNoue-Newton ML, Warner JL, Guo X, Hunter-Zinck H, Yu TV, Pilai S, Nichols C, Gardos SM, Philip J; AACR Project GENIE BPC Core Team, AACR Project GENIE Consortium; Kehl KL, Riely GJ, Schrag D, Lee J, Fiandalo MV, Sweeney SM, Pugh TJ, Sander C, Cerami E, Gao J, Schultz N. Analysis and Visualization of Longitudinal Genomic and Clinical Data from the AACR Project GENIE Biopharma Collaborative in cBioPortal. Cancer Res. 2023 Dec 1;83(23):3861-3867. doi: 10.1158/0008-5472.CAN-23-0816. PMID: 37668528; PMCID: PMC10690089.

• Please also cite the source of the data if you are using a publicly available dataset.

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Las banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget cellxgene 🍱

Query data de la base de datos CZ CELLxGENE Discover usando CZ CELLxGENE Discover Census.
Produce: Un objeto AnnData que contiene la matriz de recuentos de genes y los metadatos de resultados de single cell RNA-seq de los tejidos/genes/etcetera previamente definidos.

Antes de usar gget cellxgene por primera vez, corre gget setup cellxgene / gget.setup("cellxgene") (ver también gget setup).

Parámetros opcionales
-s --species
'homo_sapiens' o 'mus_musculus'. Por defecto: 'homo_sapiens'.

-g --gene
Str o lista de genes de interés o ID(s) tipo Ensembl. Por defecto: None (ninguno).
Atención: Utilice la bandera -e / --ensembl (Python: ensembl=True) cuando ingrese ID(s) tipo Ensembl.
Ver https://cellxgene.cziscience.com/gene-expression para ejemplos de genes.

-cv --census_version
Versión del CZ CELLxGENE Discover Census (str), p. ej. "2023-05-15", o "latest" (ultima) o "stable" (estable). Por defecto: "stable" (estable).

-cn --column_names
Lista de columnas de metadatos a obtener (almacenadas en AnnData.obs).
Por defecto: ['dataset_id', 'assay', 'suspension_type', 'sex', 'tissue_general', 'tissue', 'cell_type']
Para más opciones, ver: https://api.cellxgene.cziscience.com/curation/ui/#/ -> 'Schemas' -> 'dataset'

-o --out
Ruta al archivo para guardar el objeto AnnData formato .h5ad (o .csv con bandera -mo / --meta_only).
¡Requerido cuando se usa desde Terminal!

Banderas
-e --ensembl
Usa esta bandera si gene se ingresa como ID tipo Ensembl.

-mo --meta_only
Solo produce la tabla (Dataframe) con metadatos (corresponde a AnnData.obs).

-q --quiet
Solo para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False para impedir la información de progreso de ser exhibida durante la ejecución del programa.

Parámetros opcionales correspondientes a los atributos de metadatos de CZ CELLxGENE Discover
--tissue
Str o lista de tejido(s), p. ej. ['lung', 'blood']. Por defecto: None.
Ver https://cellxgene.cziscience.com/gene-expression para ejemplos de tejidos.

--cell_type
Str o lista de tipo(s) de célula(s), p. ej. ['mucus secreting cell', 'neuroendocrine cell']. Por defecto: None.
Ver https://cellxgene.cziscience.com/gene-expression y seleccione un tejido para ejemplos de tipos de células.

--development_stage
Str o lista de etapa(s) de desarrollo. Por defecto: None.

--disease
Str o lista de enfermedad(es). Por defecto: None.

--sex
Str o lista de sexo(s), p. ej. 'female' (femenina). Por defecto: None.

--dataset_id
Str o lista de CELLxGENE ID(s). Por defecto: None.

--tissue_general_ontology_term_id
Str o lista de tejido(s) del tipo high-level UBERON ID. Por defecto: None.
Tejidos y sus IDs tipo UBERON se enumeran aquí.

--tissue_general
Str o lista de tejido(s) del tipo high-level. Por defecto: None.
Tejidos y sus IDs de UBERON se enumeran aquí.

--tissue_ontology_term_id
Str o lista de ID(s) de 'tissue ontology term' como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--assay_ontology_term_id
Str o lista de ID(s) de 'assay ontology term' como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--assay
Str o lista de 'assays' (métodos) como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--cell_type_ontology_term_id
Str o lista de ID(s) de 'celltype ontology term' como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--development_stage_ontology_term_id
Str o lista de ID(s) de 'development stage ontology term' como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--disease_ontology_term_id
Str o lista de ID(s) de 'disease ontology term' como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--donor_id
Str o lista de ID(s) de 'donor' (donador) como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--self_reported_ethnicity_ontology_term_id
Str o lista de ID(s) de 'self-reported ethnicity ontology' como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--self_reported_ethnicity
Str o lista de etnias autoinformadas como están definidas en el esquema de datos del CELLxGENE. Por defecto: None.

--sex_ontology_term_id
Str o lista de ID(s) de 'sex ontology' como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

--suspension_type
Str o lista de tipo(s) de suspensión como están definidos en el esquema de datos del CELLxGENE. Por defecto: None.

Ejemplo

gget cellxgene --gene ACE2 ABCA1 SLC5A1 --tissue lung --cell_type 'mucus secreting cell' 'neuroendocrine cell' -o example_adata.h5ad

# Python
adata = gget.cellxgene(
    gene = ["ACE2", "ABCA1", "SLC5A1"],
    tissue = "lung",
    cell_type = ["mucus secreting cell", "neuroendocrine cell"]
)
adata

→ Produce un objeto AnnData que contiene la matriz de recuentos de scRNAseq de los genes ACE2, ABCA1 y SLC5A1 en 3322 células secretoras de mucosidad y neuroendocrinas pulmonares humanas y sus metadatos correspondientes.

Obtiene solo los metadatos (corresponde a AnnData.obs):

gget cellxgene --meta_only --gene ENSMUSG00000015405 --ensembl --tissue lung --species mus_musculus -o example_meta.csv

# Python
df = gget.cellxgene(
    meta_only = True,
    gene = "ENSMUSG00000015405",
    ensembl = True,
    tissue = "lung",  
    species = "mus_musculus"
)
df

→ Produce solo los metadatos de los conjuntos de datos de ENSMUSG00000015405 (ACE2), los cuales corresponden a células pulmonares murinas.

Ver también: https://chanzuckerberg.github.io/cellxgene-census/notebooks/api_demo/census_gget_demo.html

Citar

Si utiliza gget cellxgene en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Chanzuckerberg Initiative. (n.d.). CZ CELLxGENE Discover. Retrieved [insert date here], from https://cellxgene.cziscience.com/

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Las banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget cosmic 🪐

Busque genes, mutaciones, etc. asociados con cánceres utilizando la base de datos COSMIC (Catálogo de mutaciones somáticas en cáncer).
Produce: JSON (línea de comandos) o marco de datos/CSV (Python) cuando download_cosmic=False. Cuando download_cosmic=True, descarga la base de datos solicitada en la carpeta especificada.

Este módulo fue escrito en parte por @AubakirovArman (consulta de información) y @josephrich98 (descarga de base de datos).

NOTA: Se aplican tarifas de licencia para el uso comercial de COSMIC. Puede leer más sobre la concesión de licencias de datos COSMIC aquí.

Parámetro posicional (para consultar información)
searchterm
Término de búsqueda, que puede ser una mutación, un nombre de gen (o ID de Ensembl), una muestra, etc.
Ejemplos para los argumentos de searchterm y entidad:

NOTA: (Solo Python) Establezca en None cuando se descarguen bases de datos COSMIC con download_cosmic=True.

Parámetros opcionales (para consultar información)
-e --entity
'mutations' (predeterminado), 'genes', 'cáncer', 'sitio_tumoral', 'estudios', 'pubmed' o 'muestras'. Define el tipo de resultados a devolver.

-l --limit
Limita el número de resultados a devolver. Predeterminado: 100.

Banderas (para descargar bases de datos COSMIC)
-d --download_cosmic
Conmuta al modo de descarga de base de datos.

-gm --gget_mutate
DESACTIVA la creación de una versión modificada de la base de datos para usar con gget mutate. Python: gget_mutate es Verdadero por defecto. Establezca gget_mutate=False para deshabilitar.

Parámetros opcionales (para descargar bases de datos COSMIC)
-mc --mutation_class
'cancer' (predeterminado), 'cell_line', 'census', 'resistance', 'genome_screen', 'targeted_screen', o 'cancer_example'
Tipo de base de datos COSMIC para descargar.

-cv --cosmic_version
Versión de la base de datos COSMIC. Predeterminado: Ninguno -> Se establece en la última versión por defecto.

-gv --grch_version
Versión del genoma de referencia humano GRCh en el que se basó la base de datos COSMIC (37 o 38). Predeterminado: 37

Parámetros opcionales (generales)
-o --out
Ruta al archivo (o carpeta cuando se descargan bases de datos con el flag download_cosmic) donde se guardarán los resultados, p. ej. 'ruta/a/resultados.json'.
Predeterminado: None
-> Cuando download_cosmic=False: Los resultados se devolverán a la salida estándar
-> Cuando download_cosmic=True: La base de datos se descargará en el directorio de trabajo actual

Banderas (generales)
-csv --csv
Solo para Terminal. Produce los resultados en formato CSV.
Para Python, usa json=True para producir los resultados en formato JSON.

-q --quiet
Solo para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False para imipidir la informacion de progreso de ser exhibida durante la ejecución del programa.

Por ejemplo

Consultar información

gget cosmic -e genes EGFR

# Python
gget.cosmic("EGFR", entity="genes")

→ Devuelve mutaciones en el gen EGFR asociadas con el cáncer en el formato:

Descargar bases de datos COSMIC

gget cosmic --download_cosmic

# Python
gget.cosmic(searchterm=None, download_cosmic=True)  

→ Descargue la base de datos sobre cáncer de COSMIC de la última versión de COSMIC.

Citar

Si utiliza gget cosmic en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Tate JG, Bamford S, Jubb HC, Sondka Z, Beare DM, Bindal N, Boutselakis H, Cole CG, Creatore C, Dawson E, Fish P, Harsha B, Hathaway C, Jupe SC, Kok CY, Noble K, Ponting L, Ramshaw CC, Rye CE, Speedy HE, Stefancsik R, Thompson SL, Wang S, Ward S, Campbell PJ, Forbes SA. COSMIC: the Catalogue Of Somatic Mutations In Cancer. Nucleic Acids Res. 2019 Jan 8;47(D1):D941-D947. doi: 10.1093/nar/gky1015. PMID: 30371878; PMCID: PMC6323903.

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Las banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget diamond 💎

Alinee múltiples proteínas o secuencias de ADN traducidas usando DIAMOND (DIAMOND es similar a BLAST, pero este es un cálculo local).
Produce: Resultados en formato JSON (Terminal) o Dataframe/CSV (Python).

Parámetro posicional
query
Secuencia(s) (str o lista) de aminoácidos, o una ruta a un archivo tipo FASTA.

Parámetro requerido
-ref --reference
Secuencias de aminoácidos de referencia (str o lista), o una ruta a un archivo tipo FASTA.

Parámetros optionales
-db --diamond_db
Ruta para guardar la base de datos DIAMOND creada a partir de reference (str).
Por defecto: None -> El archivo de base de datos DIAMOND temporal se eliminará después de la alineación o se guardará en out si se proporciona out.

-s --sensitivity
Sensibilidad de la alineación (str). Por defecto: "very-sensitive" (muy sensible).
Uno de los siguientes: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive, or ultra-sensitive.

-t --threads
Número de hilos de procesamiento utilizados (int). Por defecto: 1.

-db --diamond_binary
Ruta al binario DIAMOND (str). Por defecto: None -> Utiliza el binario DIAMOND instalado automáticamente con gget.

-o --out
Ruta al archivo en el que se guardarán los resultados (str), p. ej. "ruta/al/directorio". Por defecto: salida estándar (STDOUT); los archivos temporales se eliminan.

Banderas
-u --uniprot
Use esta bandera cuando sequence es un ID de Uniprot en lugar de una secuencia de aminoácidos.

-csv --csv
Solo para Terminal. Produce los resultados en formato CSV.
Para Python, usa json=True para producir los resultados en formato JSON.

-q --quiet
Solo para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False para impedir la información de progreso de ser exhibida durante la ejecución del programa.

Ejemplo

# !!! Asegúrese de enumerar primero el argumento posicional aquí para que no se agregue como secuencia de referencia
gget diamond GGETISAWESQME ELVISISALIVE LQVEFRANKLIN PACHTERLABRQCKS -ref GGETISAWESQMEELVISISALIVELQVEFRANKLIN PACHTERLABRQCKS

# Python
gget.diamond(["GGETISAWESQME", "ELVISISALIVE", "LQVEFRANKLIN", "PACHTERLABRQCKS"], reference=["GGETISAWESQMEELVISISALIVELQVEFRANKLIN", "PACHTERLABRQCKS"])

→ Produce los resultados de la alineación en formato JSON (Terminal) o Dataframe/CSV:

Màs ejemplos

Citar

Si utiliza gget diamond en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Buchfink, B., Xie, C. & Huson, D. Fast and sensitive protein alignment using DIAMOND. Nat Methods 12, 59–60 (2015). https://doi.org/10.1038/nmeth.3176

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget elm 🎭

Prediga localmente motivos lineales eucarióticos (ELMs) a partir de una secuencia de aminoácidos o UniProt Acc utilizando datos de la base de datos ELM.
Produce: Resultados en formato JSON (Terminal) o Dataframe/CSV (Python). Este módulo devuelve dos tipos de resultados (ver ejemplos).

Los datos de ELM se pueden descargar y distribuir para uso no comercial de acuerdo con el acuerdo de licencia de software de ELM.

Antes de usar gget elm por primera vez, ejecute gget setup elm / gget.setup("elm") una vez (consulte también gget setup).

Parámetro posicional
sequence
Secuencia de aminoácidos o Uniprot Acc (str).
Al proporcionar una Uniprot Acc, use la bandera --uniprot (Python: uniprot=True).

Parámetros optionales
-s sensitivity
Sensibilidad de la alineación DIAMOND (str). Por defecto: "very-sensitive" (muy sensible).
Uno de los siguientes: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive, or ultra-sensitive.

-t threads
Número de hilos de procesamiento utilizados en la alineación de secuencias con DIAMOND (int). Por defecto: 1.

-bin diamond_binary
Ruta al binario DIAMOND (str). Por defecto: None -> Utiliza el binario DIAMOND instalado automáticamente con gget.

-o --out
Ruta al archivo en el que se guardarán los resultados (str), p. ej. "ruta/al/directorio". Por defecto: salida estándar (STDOUT); los archivos temporales se eliminan.

Banderas
-u --uniprot
Use esta bandera cuando sequence es una Uniprot Acc en lugar de una secuencia de aminoácidos.

-e --expand
Amplíe la información devuelta en el marco de datos de expresiones regulares para incluir los nombres de proteínas, los organismos y las referencias en las que se validó originalmente el motivo.

-csv --csv
Solo para Terminal. Produce los resultados en formato CSV.
Para Python, usa json=True para producir los resultados en formato JSON.

-q --quiet
Solo para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False para impedir la información de progreso de ser exhibida durante la ejecución del programa.

Ejemplo

Encuentre ELM en una secuencia de aminoácidos:

gget setup elm          # Descarga/actualiza la base de datos ELM local
gget elm -o gget_elm_results LIAQSIGQASFV

# Python
gget.setup(“elm”)      # Descarga/actualiza la base de datos ELM local
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")

Encuentre ELM que proporcionen a una UniProt Acc:

gget setup elm          # Descarga/actualiza la base de datos ELM local
gget elm -o gget_elm_results --uniprot Q02410 -e

# Python
gget.setup(“elm”)      # Descarga/actualiza la base de datos ELM local
ortholog_df, regex_df = gget.elm("Q02410", uniprot=True, expand=True)

→ Produce dos resultados con información extensa sobre ELMs asociados con proteínas ortólogas y motivos encontrados en la secuencia de entrada directamente en función de sus expresiones regex:

ortholog_df:

regex_df:

(Los motivos que aparecen en muchas especies diferentes pueden parecer repetidos, pero todas las filas deben ser únicas.)

Màs ejemplos

Citar

Si utiliza gget elm en una publicación, favor de citar los siguientes artículos:

• Laura Luebbert, Chi Hoang, Manjeet Kumar, Lior Pachter, Fast and scalable querying of eukaryotic linear motifs with gget elm, Bioinformatics, 2024, btae095, https://doi.org/10.1093/bioinformatics/btae095

• Manjeet Kumar, Sushama Michael, Jesús Alvarado-Valverde, Bálint Mészáros, Hugo Sámano‐Sánchez, András Zeke, Laszlo Dobson, Tamas Lazar, Mihkel Örd, Anurag Nagpal, Nazanin Farahi, Melanie Käser, Ramya Kraleti, Norman E Davey, Rita Pancsa, Lucía B Chemes, Toby J Gibson, The Eukaryotic Linear Motif resource: 2022 release, Nucleic Acids Research, Volume 50, Issue D1, 7 January 2022, Pages D497–D508, https://doi.org/10.1093/nar/gkab975

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Las banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget enrichr 💰

Realice un análisis de enriquecimiento de una lista de genes utilizando Enrichr.
Produce: Resultados en formato JSON (Terminal) o Dataframe/CSV (Python).

Parámetro posicional
genes
Lista de nombres cortos (símbolos) de los genes de interés para realizar el análisis de enriquecimiento, p. PHF14 RBM3 MSL1 PHF21A.
Alternativamente: use la bandera --ensembl para ingresar IDs tipo Ensembl, p. ENSG00000106443 ENSG00000102317 ENSG00000188895.

Otros parámetros requeridos
-db --database
Base de datos que será utilizada como referencia para el análisis de enriquecimiento.
Admite cualquier base de datos enumerada aquí o uno de los siguientes accesos directos:
'pathway'       (KEGG_2021_Human)
'transcription'     (ChEA_2016)
'ontology'      (GO_Biological_Process_2021)
'diseases_drugs'   (GWAS_Catalog_2019)
'celltypes'      (PanglaoDB_Augmented_2021)
'kinase_interactions'  (KEA_2015)

Parámetros opcionales
-s --species
Especies a utilizar como referencia para el análisis de enriquecimiento. (Por defecto: human)
Opciones:

-bkg_l --background_list
Lista de nombres cortos (símbolos) de genes de 'background' (de fondo/control), p. NSUN3 POLRMT NLRX1.
Alternativamente: usa la bandera --ensembl_background para ingresar IDs tipo Ensembl.

-o --out
Ruta al archivo en el que se guardarán los resultados, p. ruta/al/directorio/resultados.csv (o .json). Por defecto: salida estándar (STDOUT).
Para Python, usa save=True para guardar los resultados en el directorio de trabajo actual.

-ko --kegg_out
Ruta al archivo png en el que se guardará la imágen de la vía de señalización celular KEGG, p. ej. ruta/al/directorio/KEGG.png. (Por defecto: None)

-kr --kegg_rank
Rango de la ruta KEGG que se va a trazar. (Por defecto: 1)

figsize
Solo para Python. (ancho, alto) de la visualización en pulgadas. (Por defecto: (10,10))

ax
Solo para Python. Ingresa un objeto de ejes matplotlib para personalizar la visualización.(Por defecto: None)

Banderas
-e --ensembl
Usa esta bandera si genes se ingresa como una lista de IDs tipo Ensembl.

-e_b --ensembl_background
Usa esta bandera si background_list se ingresa como una lista de IDs tipo Ensembl.

-bkg --background
Use un conjunto de 20,625 genes 'background' listados aquí.

-csv --csv
Solo para Terminal. Produce los resultados en formato CSV.
Para Python, usa json=True produce los resultados en formato JSON.

-q --quiet
Solo para Terminal. Impide la información de progreso de ser exhibida durante la ejecución del programa.
Para Python, usa verbose=False para imipidir la información de progreso de ser exhibida durante la ejecución del programa.

plot
Solo para Python. plot=True provée la visualización de los primeros 15 resultados (por defecto: False).

Ejemplo

gget enrichr -db ontology ACE2 AGT AGTR1

# Python
gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)

→ Produce vías/funciones celulares relacionadas con los genes ACE2, AGT y AGTR1 de la base de datos GO Biological Process 2021. En Python, plot=True provee la visualización de resultados:

Use gget enrichr con una lista de genes 'background':

# Aquí, primero ingresamos los genes de interés (parámetro posicional 'genes'), para que no se agreguen a la lista de genes 'background' detrás del parámetro '-bkgr_l'
gget enrichr \
	PHF14 RBM3 MSL1 PHF21A ARL10 INSR JADE2 P2RX7 LINC00662 CCDC101 PPM1B KANSL1L CRYZL1 ANAPC16 TMCC1 CDH8 RBM11 CNPY2 HSPA1L CUL2 PLBD2 LARP7 TECPR2 ZNF302 CUX1 MOB2 CYTH2 SEC22C EIF4E3 ROBO2 ADAMTS9-AS2 CXXC1 LINC01314 ATF7 ATP5F1 \
	-db ChEA_2022 \
	-bkg_l NSUN3 POLRMT NLRX1 SFXN5 ZC3H12C SLC25A39 ARSG DEFB29 PCMTD2 ACAA1A LRRC1 2810432D09RIK SEPHS2 SAC3D1 TMLHE LOC623451 TSR2 PLEKHA7 GYS2 ARHGEF12 HIBCH LYRM2 ZBTB44 ENTPD5 RAB11FIP2 LIPT1 INTU ANXA13 KLF12 SAT2 GAL3ST2 VAMP8 FKBPL AQP11 TRAP1 PMPCB TM7SF3 RBM39 BRI3 KDR ZFP748 NAP1L1 DHRS1 LRRC56 WDR20A STXBP2 KLF1 UFC1 CCDC16 9230114K14RIK RWDD3 2610528K11RIK ACO1 CABLES1 LOC100047214 YARS2 LYPLA1 KALRN GYK ZFP787 ZFP655 RABEPK ZFP650 4732466D17RIK EXOSC4 WDR42A GPHN 2610528J11RIK 1110003E01RIK MDH1 1200014M14RIK AW209491 MUT 1700123L14RIK 2610036D13RIK PHF14 RBM3 MSL1 PHF21A ARL10 INSR JADE2 P2RX7 LINC00662 CCDC101 PPM1B KANSL1L CRYZL1 ANAPC16 TMCC1 CDH8 RBM11 CNPY2 HSPA1L CUL2 PLBD2 LARP7 TECPR2 ZNF302 CUX1 MOB2 CYTH2 SEC22C EIF4E3 ROBO2 ADAMTS9-AS2 CXXC1 LINC01314 ATF7 ATP5F1COX15 TMEM30A NSMCE4A TM2D2 RHBDD3 ATXN2 NFS1 3110001I20RIK BC038156 C330002I19RIK ZFYVE20 POLI TOMM70A LOC100047782 2410012H22RIK RILP A230062G08RIK PTTG1IP RAB1 AFAP1L1 LYRM5 2310026E23RIK SLC7A6OS MAT2B 4932438A13RIK LRRC8A SMO NUPL2

# Python
gget.enrichr(
	genes = [
		"PHF14", "RBM3", "MSL1", "PHF21A", "ARL10", "INSR", "JADE2", "P2RX7",
		"LINC00662", "CCDC101", "PPM1B", "KANSL1L", "CRYZL1", "ANAPC16", "TMCC1",
		"CDH8", "RBM11", "CNPY2", "HSPA1L", "CUL2", "PLBD2", "LARP7", "TECPR2", 
		"ZNF302", "CUX1", "MOB2", "CYTH2", "SEC22C", "EIF4E3", "ROBO2",
		"ADAMTS9-AS2", "CXXC1", "LINC01314", "ATF7", "ATP5F1"
	], 
	database = "ChEA_2022",
	background_list = [
		"NSUN3","POLRMT","NLRX1","SFXN5","ZC3H12C","SLC25A39","ARSG",
		"DEFB29","PCMTD2","ACAA1A","LRRC1","2810432D09RIK","SEPHS2",
		"SAC3D1","TMLHE","LOC623451","TSR2","PLEKHA7","GYS2","ARHGEF12",
		"HIBCH","LYRM2","ZBTB44","ENTPD5","RAB11FIP2","LIPT1",
		"INTU","ANXA13","KLF12","SAT2","GAL3ST2","VAMP8","FKBPL",
		"AQP11","TRAP1","PMPCB","TM7SF3","RBM39","BRI3","KDR","ZFP748",
		"NAP1L1","DHRS1","LRRC56","WDR20A","STXBP2","KLF1","UFC1",
		"CCDC16","9230114K14RIK","RWDD3","2610528K11RIK","ACO1",
		"CABLES1", "LOC100047214","YARS2","LYPLA1","KALRN","GYK",
		"ZFP787","ZFP655","RABEPK","ZFP650","4732466D17RIK","EXOSC4",
		"WDR42A","GPHN","2610528J11RIK","1110003E01RIK","MDH1","1200014M14RIK",
		"AW209491","MUT","1700123L14RIK","2610036D13RIK",
		"PHF14", "RBM3", "MSL1", "PHF21A", "ARL10", "INSR", "JADE2", 
		"P2RX7", "LINC00662", "CCDC101", "PPM1B", "KANSL1L", "CRYZL1", 
		"ANAPC16", "TMCC1","CDH8", "RBM11", "CNPY2", "HSPA1L", "CUL2", 
		"PLBD2", "LARP7", "TECPR2", "ZNF302", "CUX1", "MOB2", "CYTH2", 
		"SEC22C", "EIF4E3", "ROBO2", "ADAMTS9-AS2", "CXXC1", "LINC01314", "ATF7", 
		"ATP5F1""COX15","TMEM30A","NSMCE4A","TM2D2","RHBDD3","ATXN2","NFS1",
		"3110001I20RIK","BC038156","C330002I19RIK","ZFYVE20","POLI","TOMM70A",
		"LOC100047782","2410012H22RIK","RILP","A230062G08RIK",
		"PTTG1IP","RAB1","AFAP1L1", "LYRM5","2310026E23RIK",
		"SLC7A6OS","MAT2B","4932438A13RIK","LRRC8A","SMO","NUPL2"
	],
	plot=True
)

→ Provée factores de transcripción relacionados a los genes de interés y controlados con la lista de genes background de la base de datos ChEA 2022. En Python, plot=True permite la visualización de resultados:

Genere una imagen de la vía de señalización de células KEGG con los genes del análisis de enriquecimiento resaltados:
Esta función está disponible gracias a un PR de Noriaki Sato.

gget enrichr -db pathway --kegg_out kegg.png --kegg_rank 1 ZBP1 IRF3 RIPK1

# Python
gget.enrichr(["ZBP1", "IRF3", "RIPK1"], database="pathway", kegg_out="kegg.png", kegg_rank=1)

→ Además de los resultados estándar gget enrichr, el argumento kegg_out guarda una imagen con los genes del análisis de enriquecimiento resaltados guardado como kegg.png:

El siguiente ejemplo fue enviado por Dylan Lawless a través de un PR (con ajustes de Laura Luebbert):
Use gget enrichr en R y cree unq visualización similar usando ggplot.
TENGA EN CUENTA el cambio de ejes en comparación con la visualización en Python.

system("pip install gget")
install.packages("reticulate")
library(reticulate)
gget <- import("gget")

# Perform enrichment analysis on a list of genes
df <- gget$enrichr(list("ACE2", "AGT", "AGTR1"), database = "ontology")

# Count number of overlapping genes
df$overlapping_genes_count <- lapply(df$overlapping_genes, length) |> as.numeric()

# Only keep the top 15 results
df <- df[1:15, ]

# Plot
library(ggplot2)

df |>
	ggplot() +
	geom_bar(aes(
		x = -log10(adj_p_val),
		y = reorder(path_name, -adj_p_val)
	),
	stat = "identity",
  	fill = "lightgrey",
  	width = 0.5,
	color = "black") +
	geom_text(
		aes(
			y = path_name,
			x = (-log10(adj_p_val)),
			label = overlapping_genes_count
		),
		nudge_x = 0.75,
		show.legend = NA,
		color = "red"
	) +
  	geom_text(
		aes(
			y = Inf,
			x = Inf,
      			hjust = 1,
      			vjust = 1,
			label = "# of overlapping genes"
		),
		show.legend = NA,
		color = "red"
	) +
	geom_vline(linetype = "dotted", linewidth = 1, xintercept = -log10(0.05)) +
	ylab("Pathway name") +
	xlab("-log10(adjusted P value)")

Más ejemplos

Citar

Si utiliza gget enrichr en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Chen EY, Tan CM, Kou Y, Duan Q, Wang Z, Meirelles GV, Clark NR, Ma'ayan A. Enrichr: interactive and collaborative HTML5 gene list enrichment analysis tool. BMC Bioinformatics. 2013; 128(14). https://doi.org/10.1186/1471-2105-14-128

• Kuleshov MV, Jones MR, Rouillard AD, Fernandez NF, Duan Q, Wang Z, Koplev S, Jenkins SL, Jagodnik KM, Lachmann A, McDermott MG, Monteiro CD, Gundersen GW, Ma'ayan A. Enrichr: a comprehensive gene set enrichment analysis web server 2016 update. Nucleic Acids Research. 2016; gkw377. doi: 10.1093/nar/gkw377

• Xie Z, Bailey A, Kuleshov MV, Clarke DJB., Evangelista JE, Jenkins SL, Lachmann A, Wojciechowicz ML, Kropiwnicki E, Jagodnik KM, Jeon M, & Ma’ayan A. Gene set knowledge discovery with Enrichr. Current Protocols, 1, e90. 2021. doi: 10.1002/cpz1.90.

Si trabaja con conjuntos de datos no humanos/ratón, cite también:

• Kuleshov MV, Diaz JEL, Flamholz ZN, Keenan AB, Lachmann A, Wojciechowicz ML, Cagan RL, Ma'ayan A. modEnrichr: a suite of gene set enrichment analysis tools for model organisms. Nucleic Acids Res. 2019 Jul 2;47(W1):W183-W190. doi: 10.1093/nar/gkz347. PMID: 31069376; PMCID: PMC6602483.

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget gpt 💬

Genera texto en lenguaje natural basado en mensaje de entrada. gget gpt use la API 'openai.ChatCompletion.create' de OpenAI. Este módulo, incluido su código, documentación y pruebas unitarias, fue escrito en parte por Chat-GTP3 de OpenAI.

TENGA EN CUENTA:
Las llamadas a la API de OpenAI solo son 'gratuitas' durante los primeros tres meses después de generar su cuenta de OpenAI (OpenAI proporciona un crédito de $5 que vence).
Puede definir un límite de facturación mensual estricto (por ejemplo, $1) aquí.
Vea sus precios y preguntas frecuentes aquí.
Obtenga su clave API de OpenAI aquí.

Regresa: El texto generado (str).

Antes de usar gget gpt por primera vez, corre gget setup gpt / gget.setup("gpt") (ver también gget setup).

Parámetros posicionales
prompt
Mensaje de entrada basado en el cual generar texto (str).

api_key
Su clave API de OpenAI (str) (obtenga su clave API).

Parámetros optionales
-m --model
El nombre del algoritmo GPT que se usará para generar el texto (str). Por defecto: "gpt-3.5-turbo".
See https://platform.openai.com/docs/models/gpt-4 for more information on the available models.

-temp --temperature
Valor entre 0 y 2 que controla el nivel de aleatoriedad y creatividad en el texto generado (float).
Los valores más altos resultan en un texto más creativo y variado. Por defecto: 1.

-tp --top_p
Controla la diversidad del texto generado como alternativa al muestreo con --temperature (float).
Los valores más altos resultan en un texto más diverso e inesperado. Por defecto: 1.
Tenga en cuenta que OpenAI recomienda modificar --top_p o el parámetro --temperature, pero no ambas.

-s --stop
Una secuencia de tokens para marcar el final del texto generado (str). Por defecto: None.

-mt --max_tokens
Controla la longitud máxima del texto generado, en tokens (int). Por defecto: 200.

-pp --presence_penalty
Número entre -2.0 y 2.0. Los valores más altos aumentan la probabilidad de que el modelo hable sobre temas nuevos (float). Por defecto: 0.

-fp --frequency_penalty
Número entre -2.0 y 2.0. Los valores más altos reducen la probabilidad de que el modelo repita la misma línea palabra por palabra (float). Por defecto: 0.

-lb --logit_bias
Un diccionario que especifica un sesgo hacia ciertos tokens en el texto generado (dict). Por defecto: None.

-o --out
Ruta al archivo en el que se guardarán los resultados, p. ej. ruta/al/directorio/resultados.txt. Por defecto: salida estándar (STDOUT).

Por ejemplo

gget gpt "Cómo estás hoy GPT?" su_clave_api

# Python
print(gget.gpt("Cómo estás hoy GPT?", "su_clave_api"))

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget info 💡

Obtenga información detallada sobre genes y transcripciones de Ensembl, UniProt y NCBI utilizando sus IDs del tipo Ensembl.
Regresa: Resultados en formato JSON (Terminal) o Dataframe/CSV (Python).

Parámetro posicional
ens_ids
Uno o más ID del tipo Ensembl.
NOTA: Proporcionar una lista de más de 1000 ID de Ensembl a la vez puede provocar un error del servidor (para procesar más de 1000 ID, divida la lista de ID en fragmentos de 1000 ID y ejecútelos por separado).

Parámetros optionales
-o --out
Ruta al archivo en el que se guardarán los resultados, p. ej. ruta/al/directorio/resultados.csv (o .json). Por defecto: salida estándar (STDOUT).
Para Python, usa save=True para guardar los resultados en el directorio de trabajo actual.

Banderas
-n --ncbi
DESACTIVA los resultados de NCBI.
Para Python: ncbi=False evita la incluida de datos de NCBI (por defecto: True).

-u --uniprot
DESACTIVA los resultados de UniProt.
Para Python: uniprot=False evita la incluida de datos de UniProt (por defecto: True).

-pdb --pdb
INCLUYE PDB IDs en los resultados (podría aumentar el tiempo de ejecución).
Para Python: pdb=True incluye IDs de PDB en los resultados (por defecto: False).

-csv --csv
Solo para la Terminal. Regresa los resultados en formato CSV.
Para Python, usa json=True para regresar los resultados en formato JSON.

-q --quiet
Solo para la Terminal. Impide la informacion de progreso de ser exhibida durante la corrida.
Para Python, usa verbose=False para imipidir la informacion de progreso de ser exhibida durante la corrida.

wrap_text
Solo para Python. wrap_text=True muestra los resultados con texto envuelto para facilitar la lectura (por defecto: False).

Por ejemplo

gget info ENSG00000034713 ENSG00000104853 ENSG00000170296

# Python
gget.info(["ENSG00000034713", "ENSG00000104853", "ENSG00000170296"])

→ Regresa información detallada sobre cada ID de Ensembl ingresada:

More examples

Citar

Si utiliza gget info en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Martin FJ, Amode MR, Aneja A, Austine-Orimoloye O, Azov AG, Barnes I, Becker A, Bennett R, Berry A, Bhai J, Bhurji SK, Bignell A, Boddu S, Branco Lins PR, Brooks L, Ramaraju SB, Charkhchi M, Cockburn A, Da Rin Fiorretto L, Davidson C, Dodiya K, Donaldson S, El Houdaigui B, El Naboulsi T, Fatima R, Giron CG, Genez T, Ghattaoraya GS, Martinez JG, Guijarro C, Hardy M, Hollis Z, Hourlier T, Hunt T, Kay M, Kaykala V, Le T, Lemos D, Marques-Coelho D, Marugán JC, Merino GA, Mirabueno LP, Mushtaq A, Hossain SN, Ogeh DN, Sakthivel MP, Parker A, Perry M, Piližota I, Prosovetskaia I, Pérez-Silva JG, Salam AIA, Saraiva-Agostinho N, Schuilenburg H, Sheppard D, Sinha S, Sipos B, Stark W, Steed E, Sukumaran R, Sumathipala D, Suner MM, Surapaneni L, Sutinen K, Szpak M, Tricomi FF, Urbina-Gómez D, Veidenberg A, Walsh TA, Walts B, Wass E, Willhoft N, Allen J, Alvarez-Jarreta J, Chakiachvili M, Flint B, Giorgetti S, Haggerty L, Ilsley GR, Loveland JE, Moore B, Mudge JM, Tate J, Thybert D, Trevanion SJ, Winterbottom A, Frankish A, Hunt SE, Ruffier M, Cunningham F, Dyer S, Finn RD, Howe KL, Harrison PW, Yates AD, Flicek P. Ensembl 2023. Nucleic Acids Res. 2023 Jan 6;51(D1):D933-D941. doi: 10.1093/nar/gkac958. PMID: 36318249; PMCID: PMC9825606.

• Sayers EW, Beck J, Bolton EE, Brister JR, Chan J, Comeau DC, Connor R, DiCuccio M, Farrell CM, Feldgarden M, Fine AM, Funk K, Hatcher E, Hoeppner M, Kane M, Kannan S, Katz KS, Kelly C, Klimke W, Kim S, Kimchi A, Landrum M, Lathrop S, Lu Z, Malheiro A, Marchler-Bauer A, Murphy TD, Phan L, Prasad AB, Pujar S, Sawyer A, Schmieder E, Schneider VA, Schoch CL, Sharma S, Thibaud-Nissen F, Trawick BW, Venkatapathi T, Wang J, Pruitt KD, Sherry ST. Database resources of the National Center for Biotechnology Information. Nucleic Acids Res. 2024 Jan 5;52(D1):D33-D43. doi: 10.1093/nar/gkad1044. PMID: 37994677; PMCID: PMC10767890.

• The UniProt Consortium , UniProt: the Universal Protein Knowledgebase in 2023, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D523–D531, https://doi.org/10.1093/nar/gkac1052

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget muscle 🦾

Alinea múltiples secuencias de nucleótidos o aminoácidos usando el algoritmo Muscle5.
Regresa: Salida estándar (STDOUT) en formato ClustalW o archivo de tipo 'aligned FASTA' (.afa).

Parámetro posicional
fasta
Lista de secuencias o ruta al archivo FASTA o .txt que contiene las secuencias de nucleótidos o aminoácidos que se van a alinear.

Parámetros optionales
-o --out
Ruta al archivo en el que se guardarán los resultados, p. ej. ruta/al/directorio/resultados.afa. Por defecto: salida estándar (STDOUT).
Para Python, usa save=True para guardar los resultados en el directorio de trabajo actual.

Banderas
-s5 --super5
Alinea las secuencies usando el algoritmo Super5 en lugar del algoritmo Parallel Perturbed Probcons (PPP) para disminuir el tiempo y la memoria usada durante la corrida.
Use para ingresos grandes (unos cientos secuencias).

-q --quiet
Solo para la Terminal. Impide la informacion de progreso de ser exhibida durante la corrida.
Para Python, usa verbose=False para imipidir la informacion de progreso de ser exhibida durante la corrida.

Por ejemplo

gget muscle MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS

# Python
gget.muscle(["MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS", "MSSSSWLLLSLVEVTAAQSTIEQQAKTFLDKFHEAEDLFYQSLLAS"])

gget muscle fasta.fa

# Python
gget.muscle("fasta.fa")

→ Regresa las secuencias alineadas con coloración ClustalW. (Para devolver un archivo FASTA alineado (.afa), use el argumento --out (o save=True en Python).) En este ejemplo, el archivo 'fasta.fa' incluye varias secuencias para alineación (por ejemplo, isoformas devueltas desde gget seq).

También puede ver archivos FASTA alineados devueltos por gget.muscle usando programas como alv:

# Python
!pip install biopython
!pip install alv
from Bio import AlignIO
import alv

gget.muscle("fasta.fa", out="fasta_aligned.afa")
msa = AlignIO.read("fasta_aligned.afa", "fasta")
alv.view(msa)

More examples

Citar

Si utiliza gget muscle en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

• Edgar RC (2021), MUSCLE v5 enables improved estimates of phylogenetic tree confidence by ensemble bootstrapping, bioRxiv 2021.06.20.449169. https://doi.org/10.1101/2021.06.20.449169

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget mutate 🧟

Recibe secuencias de nucleótidos y mutaciones (en anotación de mutación estándar) y devuelve versiones mutadas de las secuencias según las mutaciones proporcionadas.
Resultado: Guarda las secuencias mutadas en formato FASTA (o devuelve una lista que contiene las secuencias mutadas si out=None).

Este módulo fue coescrito por Joseph Rich.

Argumento posicional
sequences
Ruta al archivo FASTA que contiene las secuencias a ser mutadas, por ejemplo, 'path/to/seqs.fa'.
Los identificadores de las secuencias que siguen al carácter '>' deben corresponder a los identificadores en la columna seq_ID de mutations.

Formato de ejemplo del archivo FASTA:

>seq1 (or ENSG00000106443)  
ACTGCGATAGACT  
>seq2  
AGATCGCTAG

Alternativamente: Secuencia(s) de entrada como una cadena o lista, por ejemplo, 'AGCTAGCT'.

NOTA: Solo se utilizarán las letras hasta el primer espacio o punto como identificadores de secuencias; se ignorarán los números de versión de los IDs de Ensembl.
NOTA: Cuando la entrada sequences es un archivo fasta de genoma, consulte también el argumento gtf a continuación.

Argumentos requeridos
-m --mutations
Ruta al archivo csv o tsv (por ejemplo, 'path/to/mutations.csv') o marco de datos (objeto DataFrame) que contiene información sobre las mutaciones en el siguiente formato (las columnas 'notes' y 'mut_ID' son opcionales):

'mutation' = Columna que contiene las mutaciones a realizar escritas en la anotación estándar de mutaciones
'mut_ID' = Columna que contiene el identificador para cada mutación
'seq_ID' = Columna que contiene los identificadores de las secuencias a ser mutadas (deben corresponder a la cadena que sigue al carácter '>' en el archivo FASTA 'sequences'; NO incluya espacios ni puntos)

Alternativamente: Mutación(es) de entrada como una cadena o lista, por ejemplo, 'c.2C>T'.
Si se proporciona una lista, el número de mutaciones debe ser igual al número de secuencias de entrada.

Para usar desde la terminal (bash): Enciérrale las anotaciones de mutación individuales entre comillas para evitar errores de análisis.

Argumentos opcionales relacionados con la entrada
-mc --mut_column
Nombre de la columna que contiene las mutaciones a realizar en mutations. Predeterminado: 'mutation'.

-sic --seq_id_column
Nombre de la columna que contiene los ID de las secuencias a ser mutadas en mutations. Predeterminado: 'seq_ID'.

-mic --mut_id_column
Nombre de la columna que contiene los IDs de cada mutación en mutations. Predeterminado: Igual que mut_column.

-gtf --gtf
Ruta a un archivo .gtf. Al proporcionar un archivo fasta de genoma como entrada para 'sequences', puede proporcionar un archivo .gtf aquí y las secuencias de entrada se definirán de acuerdo con los límites de los transcritos, por ejemplo, 'path/to/genome_annotation.gtf'. Predeterminado: Ninguno

-gtic --gtf_transcript_id_column
Nombre de la columna en el archivo de entrada mutations que contiene el ID del transcrito. En este caso, la columna seq_id_column debe contener el número de cromosoma.
Requerido cuando se proporciona gtf. Predeterminado: Ninguno

Argumentos opcionales para la generación/filtrado de secuencias mutantes
-k --k
Longitud de las secuencias que flanquean la mutación. Predeterminado: 30.
Si k > longitud total de la secuencia, se mantendrá toda la secuencia.

-msl --min_seq_len
Longitud mínima de la secuencia de salida mutante, por ejemplo, 100. Las secuencias mutantes más pequeñas que esto serán descartadas. Predeterminado: Ninguno

-ma --max_ambiguous
Número máximo de caracteres 'N' (o 'n') permitidos en la secuencia de salida, por ejemplo, 10. Predeterminado: Ninguno (no se aplicará filtro de caracteres ambiguos)

Banderas opcionales para la generación/filtrado de secuencias mutantes
-ofr --optimize_flanking_regions
Elimina nucleótidos de cualquiera de los extremos de la secuencia mutante para asegurar (cuando sea posible) que la secuencia mutante no contenga ningún k-mer que también se encuentre en la secuencia de tipo salvaje/entrada.

-rswk --remove_seqs_with_wt_kmers
Elimina las secuencias de salida donde al menos un k-mer también está presente en la secuencia de tipo salvaje/entrada en la misma región.
Cuando se utiliza con --optimize_flanking_regions, solo se eliminarán las secuencias para las cuales un k-mer de tipo salvaje aún está presente después de la optimización.

-mio --merge_identical_off
No fusionar secuencias mutantes idénticas en la salida (por defecto, las secuencias idénticas se fusionarán concatenando los encabezados de secuencia para todas las secuencias idénticas).

Argumentos opcionales para generar salida adicional
Esta salida se activa utilizando la bandera --update_df y se almacenará en una copia del DataFrame mutations.

-udf_o --update_df_out
Ruta al archivo csv de salida que contiene el DataFrame actualizado, por ejemplo, 'path/to/mutations_updated.csv'. Solo válido cuando se usa con --update_df.
Predeterminado: Ninguno -> el nuevo archivo csv se guardará en el mismo directorio que el DataFrame mutations con el apéndice '_updated'

-ts --translate_start
(int o str) La posición en la secuencia de nucleótidos de entrada para comenzar a traducir, por ejemplo, 5. Si se proporciona una cadena, debe corresponder a un nombre de columna en mutations que contenga las posiciones de inicio del marco de lectura abierto para cada secuencia/mutación. Solo válido cuando se usa con --translate.
Predeterminado: traduce desde el principio de cada secuencia

-te --translate_end
(int o str) La posición en la secuencia de nucleótidos de entrada para finalizar la traducción, por ejemplo, 35. Si se proporciona una cadena, debe corresponder a un nombre de columna en mutations que contenga las posiciones de fin del marco de lectura abierto para cada secuencia/mutación. Solo válido cuando se usa con --translate.
Predeterminado: traduce hasta el final de cada secuencia

Banderas opcionales para modificar salida adicional
-udf --update_df
Actualiza el DataFrame de entrada mutations para incluir columnas adicionales con el tipo de mutación, la secuencia de nucleótidos de tipo salvaje y la secuencia de nucleótidos mutante (solo válido si mutations es un archivo .csv o .tsv).

-sfs --store_full_sequences
Incluye las secuencias completas de tipo salvaje y mutantes en el DataFrame actualizado mutations (no solo la sub-secuencia con flancos de longitud k). Solo válido cuando se usa con --update_df.

-tr --translate
Agrega columnas adicionales al DataFrame actualizado mutations que contienen las secuencias de aminoácidos de tipo salvaje y mutantes. Solo válido cuando se usa con --store_full_sequences.

Argumentos generales opcionales
-o --out
Ruta al archivo FASTA de salida que contiene las secuencias mutadas, por ejemplo, 'path/to/output_fasta.fa'.
Predeterminado: Ninguno -> devuelve una lista de las secuencias mutadas a la salida estándar.
Los identificadores (que siguen al '>') de las secuencias mutadas en el FASTA de salida serán '>[seq_ID]_[mut_ID]'.

Banderas generales opcionales
-q --quiet
Solo en línea de comandos. Previene que se muestre información de progreso.
Python: Usa verbose=False para prevenir que se muestre información de progreso.

Ejemplos

gget mutate ATCGCTAAGCT -m 'c.4G>T'

# Python
gget.mutate("ATCGCTAAGCT", "c.4G>T")

→ Devuelve ATCTCTAAGCT.

Lista de secuencias con una mutación para cada secuencia proporcionada en una lista:

gget mutate ATCGCTAAGCT TAGCTA -m 'c.4G>T' 'c.1_3inv' -o mut_fasta.fa

# Python
gget.mutate(["ATCGCTAAGCT", "TAGCTA"], ["c.4G>T", "c.1_3inv"], out="mut_fasta.fa")

→ Guarda el archivo 'mut_fasta.fa' que contiene:

>seq1_mut1  
ATCTCTAAGCT  
>seq2_mut2  
GATCTA

Una mutación aplicada a varias secuencias con k ajustado:

gget mutate ATCGCTAAGCT TAGCTA -m 'c.1_3inv' -k 3

# Python
gget.mutate(["ATCGCTAAGCT", "TAGCTA"], "c.1_3inv", k=3)

→ Devuelve ['CTAGCT', 'GATCTA'].

Agregar mutaciones a un genoma completo con salida extendida
Entrada principal:

• información de mutación como un CSV de mutations (teniendo seq_id_column que contenga información de cromosoma, y mut_column que contenga información de mutación con respecto a las coordenadas del genoma)
• el genoma como el archivo sequences

Dado que estamos pasando la ruta a un archivo gtf al argumento gtf, se respetarán los límites de los transcritos (el genoma se dividirá en transcritos). gtf_transcript_id_column especifica el nombre de la columna en mutations que contiene los IDs de los transcritos correspondientes a los IDs de transcritos en el archivo gtf.

El argumento optimize_flanking_regions maximiza la longitud de las secuencias resultantes que contienen la mutación manteniendo la especificidad (ningún k-mer de tipo salvaje se mantendrá).

update_df activa la creación de un nuevo archivo CSV con información actualizada sobre cada secuencia de entrada y salida. Este nuevo archivo CSV se guardará como update_df_out. Dado que store_full_sequences está activado, este nuevo archivo CSV no solo contendrá las secuencias de salida (restringidas en tamaño por las regiones flanqueantes de tamaño k), sino también las secuencias completas de entrada y salida. Esto nos permite observar la mutación en el contexto de la secuencia completa. Por último, también estamos agregando las versiones traducidas de las secuencias completas mediante la activación de la bandera translate, para que podamos observar cómo cambia la secuencia de aminoácidos resultante. Los argumentos translate_start y translate_end especifican los nombres de las columnas en mutations que contienen las posiciones de inicio y fin del marco de lectura abierto (posiciones de inicio y fin para traducir la secuencia de nucleótidos a una secuencia de aminoácidos), respectivamente.

gget mutate \
  -m mutations_input.csv \
  -o mut_fasta.fa \
  -k 4 \
  -sic Chromosome \
  -mic Mutation \
  -gtf genome_annotation.gtf \
  -gtic Ensembl_Transcript_ID \
  -ofr \
  -update_df \
  -udf_o mutations_updated.csv \
  -sfs \
  -tr \
  -ts Translate_Start \
  -te Translate_End \
  genome_reference.fa

# Python
gget.mutate(
  sequences="genome_reference.fa",
  mutations="mutations_input.csv",
  out="mut_fasta.fa",
  k=4,
  seq_id_column="Chromosome",
  mut_column="Mutation",
  gtf="genome_annotation.gtf",
  gtf_transcript_id_column="Ensembl_Transcript_ID",
  optimize_flanking_regions=True,
  update_df=True,
  update_df_out="mutations_updated.csv",
  store_full_sequences=True,
  translate=True,
  translate_start="Translate_Start",
  translate_end="Translate_End"
)

→ Toma un genoma fasta ('genome_reference.fa') y un archivo gtf ('genome_annotation.gtf') (estos se pueden descargar usando gget ref), así como un archivo 'mutations_input.csv' que contiene:

| Chromosome | Mutation          | Ensembl_Transcript_ID  | Translate_Start | Translate_End |
|------------|-------------------|------------------------|-----------------|---------------|
| 1          | g.224411A>C       | ENST00000193812        | 0               | 100           |
| 8          | g.25111del        | ENST00000174411        | 0               | 294           |
| X          | g.1011_1012insAA  | ENST00000421914        | 9               | 1211          |

→ Guarda el archivo 'mut_fasta.fa' que contiene:

>1:g.224411A>C  
TGCTCTGCT  
>8:g.25111del  
GAGTCGAT
>X:g.1011_1012insAA
TTAGAACTT

→ Guarda el archivo 'mutations_updated.csv' que contiene:

| Chromosome | Mutation          | Ensembl_Transcript_ID  | mutation_type | wt_sequence | mutant_sequence | wt_sequence_full  | mutant_sequence_full | wt_sequence_aa_full | mutant_sequence_aa_full |
|------------|-------------------|------------------------|---------------|-------------|-----------------|-------------------|----------------------|---------------------|-------------------------|
| 1          | g.224411A>C       | ENSMUST00000193812     | Substitution  | TGCTATGCT   | TGCTCTGCT       | ...TGCTATGCT...   | ...TGCTCTGCT...      | ...CYA...           | ...CSA...               |
| 8          | g.25111del        | ENST00000174411        | Deletion      | GAGTCCGAT   | GAGTCGAT        | ...GAGTCCGAT...   | ...GAGTCGAT...       | ...ESD...           | ...ES...                |
| X          | g.1011_1012insAA  | ENST00000421914        | Insertion     | TTAGCTT     | TTAGAACTT       | ...TTAGCTT...     | ...TTAGAACTT...      | ...A...             | ...EL...                |

Citar

Si utiliza gget mutate en una publicación, favor de citar los siguientes artículos:

• Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

Parámetros de Python són iguales a los parámetros largos (--parámetro) de Terminal, si no especificado de otra manera. Banderas son parámetros de verdadero o falso (True/False) en Python. El manuál para cualquier modulo de gget se puede llamar desde la Terminal con la bandera -h --help.

gget opentargets 🎯

Obtenga enfermedades o fármacos asociados con ciertos genes desde OpenTargets.
Formato de salida: JSON/CSV (línea de comandos) o marco de datos (Python).

Este módulo fue escrito por Sam Wagenaar.

Argumento posicional
ens_id
ID de gen Ensembl, por ejemplo, ENSG00000169194.

Argumentos opcionales
-r --resource
Define el tipo de información a devolver en la salida. Predeterminado: 'diseases' (enfermedades).
Los recursos posibles son:

-l --limit
Limitar el número de resultados, por ejemplo, 10. Predeterminado: Sin límite.
Nota: No es compatible con los recursos tractability y depmap.

-o --out
Ruta al archivo JSON donde se guardarán los resultados, por ejemplo, path/to/directory/results.json. Predeterminado: Salida estándar.
Python: save=True guardará la salida en el directorio de trabajo actual.

Argumentos opcionales de filtrado

-fd --filter_disease disease_id
Filtrar por ID de enfermedad, por ejemplo, 'EFO_0000274'. Válido solo para el recurso drugs.

-fc --filter_drug drug_id
Filtrar por ID de fármaco, por ejemplo, 'CHEMBL1743081'. Válido solo para el recurso pharmacogenetics.

-ft --filter_tissue tissue_id
Filtrar por ID de tejido, por ejemplo, 'UBERON_0000473'. Válido solo para los recursos expression y depmap.

-fa --filter_anat_sys
Filtrar por sistema anatómico, por ejemplo, 'sistema nervioso'. Válido solo para el recurso expression.

-fo --filter_organ anatomical_system
Filtrar por órgano, por ejemplo, 'cerebro'. Válido solo para el recurso expression.

-fpa --filter_protein_a protein_a_id
Filtrar por ID de la primera proteína en la interacción, por ejemplo, 'ENSP00000304915'. Válido solo para el recurso interactions.

-fpb --filter_protein_b protein_b_id
Filtrar por ID de la segunda proteína en la interacción, por ejemplo, 'ENSP00000379111'. Válido solo para el recurso interactions.

-fgb --filter_gene_b gene_b_id
Filtrar por ID de gen de la segunda proteína en la interacción, por ejemplo, 'ENSG00000077238'. Válido solo para el recurso interactions.

filters
Solo para Python. Un diccionario de filtros, por ejemplo:

{'disease_id': ['EFO_0000274', 'HP_0000964']}

`filter_mode`  
Solo para Python. `filter_mode='or'` combina filtros de diferentes IDs con lógica OR.  
`filter_mode='and'` combina filtros de diferentes IDs con lógica AND (predeterminado).

**Banderas**   
`-csv` `--csv`  
Solo en línea de comandos. Devuelve la salida en formato CSV, en lugar de formato JSON.  
Python: Use `json=True` para devolver la salida en formato JSON.

`-q` `--quiet`   
Solo en línea de comandos. Evita que se muestre la información de progreso.  
Python: Use `verbose=False` para evitar que se muestre la información de progreso. 

`-or` `--or`  
Solo en línea de comandos. Los filtros se combinan con lógica OR. Predeterminado: lógica AND.

`wrap_text`  
Solo para Python. `wrap_text=True` muestra el marco de datos con texto ajustado para facilitar la lectura (predeterminado: False).

### Ejemplos

**Obtenga enfermedades asociadas a un gen específico:**   
```bash
gget opentargets ENSG00000169194 -r diseases -l 1

# Python
import gget
gget.opentargets('ENSG00000169194', resource='diseases', limit=1)

→ Devuelve la principal enfermedad asociada con el gen ENSG00000169194.

Obtener medicamentos asociados para un gen específico:

gget opentargets ENSG00000169194 -r drugs -l 2

# Python
import gget
gget.opentargets('ENSG00000169194', resource='drugs', limit=2)

→ Devuelve los 2 principales medicamentos asociados con el gen ENSG00000169194.

Note: Los trial_ids devueltos son identificadores de ClinicalTrials.gov

Obtenga datos de trazabilidad para un gen específico:

gget opentargets ENSG00000169194 -r tractability

# Python
import gget
gget.opentargets('ENSG00000169194', resource='tractability')

→ Devuelve datos de trazabilidad para el gen ENSG00000169194.

Obtenga respuestas farmacogenéticas para un gen específico:

gget opentargets ENSG00000169194 -r pharmacogenetics -l 1

# Python
import gget
gget.opentargets('ENSG00000169194', resource='pharmacogenetics', limit=1)

→ Devuelve respuestas farmacogenéticas para el gen ENSG00000169194.

Note: Los identificadores de literature devueltos son identificadores de PMC de Europa

Obtenga tejidos donde un gen se expresa más: